KEGG   Clavispora lusitaniae ATCC 42720: CLUG_01402Help
Entry
CLUG_01402        CDS       T01149                                 

Definition
(RefSeq) similar to acetyl-coenzyme A synthase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00010  Glycolysis / Gluconeogenesis
clu00620  Pyruvate metabolism
clu00640  Propanoate metabolism
clu00680  Methane metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
clu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLUG_01402
   00620 Pyruvate metabolism
    CLUG_01402
   00640 Propanoate metabolism
    CLUG_01402
  Energy metabolism
   00680 Methane metabolism
    CLUG_01402
Enzymes [BR:clu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CLUG_01402
Lipid biosynthesis proteins [BR:clu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CLUG_01402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 8498807
NCBI-ProteinID: XP_002617943
UniProt: C4XZM0
AA seq 675 aa AA seqDB search
MTHTVVHEANGVTPRHTPKEFYARQPAKGHIESLEQYQQMYQQSINDPEAFFGPMAKELL
HWDRPFTKVKAGGLAHGDPQWFIGGELNACYNCVDRWAYAHPDKPALIYEADDEKDSRTL
TYGELLREVSAVAGVLQSWGVTKGDNVAIYLPMNAHAVVAMLAVARLGAVHSVIFAGFSA
GSIRDRVNDAGCKALITCDEGKRGGKTINIKKLCDEALQSCPSVEKVLVHRRTGNPDIAT
VAGRDFWWDEETAKFPGYLPPVSVNAEDPLFLLYTSGSTGSPKGVVHTTGGYLLGAAMST
KYVFDVHSSDVVFTAGDVGWITGHTYALYGPLLLGVPTVVFEGTPAYPDYGRLFQIIDKH
RATHFYIAPTALRLLRKAGEHEIEKYDLTSLRTLGSVGEPISPDIWEWYHEKIGRGQCHI
SDTYWQTESGSHFIAPLAGVTPNKPGSASLPLFGIDACIIDPVSGHEVKGNDVEGVLAIK
NTWPSMARSVYRNHQKYMDTYLKPYPGYYFTGDGAARDHDGYYWIRGRVDDVVNVSGHRL
STAEIEAALIEHHGVSESAVVGINDDLTGQAVVAFVALKDEVADAINGNETSEEAFALRR
ELVLVVRKEIGPFAAPKSVIIVQDLPKTRSGKIMRRILRKISSNEADQLGDISTLANPQS
VAGIIDSFAAQFGKK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgacccatacggttgtacacgaggccaacggcgtcaccccacgtcacactccaaaagag
ttttatgcccggcagcctgccaagggccacattgagtccttggagcagtaccaacagatg
taccaacaatccattaatgacccagaggctttttttggtcccatggccaaggaattgttg
cactgggatagaccattcaccaaggtcaaggctggcggtcttgcccatggtgatccacaa
tggtttatcggtggtgaattgaacgcatgctacaactgtgttgatcgttgggcctatgct
cacccagacaagcctgcactcatttacgaggctgatgatgagaaggactcccgtaccctc
acgtatggtgaacttttgcgcgaggtcagtgctgttgctggtgttttgcagagctggggt
gttaccaaaggcgacaatgttgccatttacttgcctatgaacgctcacgctgttgtggcc
atgttggccgtggctcgtttgggtgctgtacacctggtgatctttgctggtttctctgct
ggatccatccgcgaccgtgtgaatgatgctggatgcaaggctttgattacttgtgacgag
ggtaagcgtggtggtaagaccatcaacatcaagaagttatgtgacgaggctttgcaatcg
tgcccatcagtggaaaaggtgttggttcaccgcagaacaggtaaccctgacattgcgact
gttgctggtcgtgacttctggtgggatgaggaaactgccaagttcccaggttatcttcca
cctgtgtctgtcaacgctgaggacccattgttcttgttgtacacttcgggctctaccggc
tctccaaagggtgtggttcacactactggtggttacttgcttggtgcagctatgtccacc
aaatacgtttttgatgtgcattccctggatgttgtctttactgcaggtgatgttggctgg
atcaccggccacacctatgccctttacggtcctctccttttgggtgtcccaacggtggtg
ttcgaaggtacacctgcttaccctgactacggtcgtttgttccagatcatcgataagcac
cgcgcaacacacttttacatcgctcctactgcgttgcgtcttttgagaaaggctggcgaa
cacgagattgaaaagtacgacttgacatcgttgagaaccttgggttccgtcggtgagcct
atttccccagacatttgggagtggtaccatgaaaagattggccgtggccagtgtcacatc
tcggacacttactggcagacagagagtggttcgcacttcattgctccactcgctggtgtt
acacccaacaagcctggcctggcctctttgcctctctttggtattgacgcatgcatcatc
gacccggtgtcgggccacgaagtcaagggcaatgatgtagagggtgttttggcgatcaag
aacacatggccatctatggcacgttctgtgtaccgtaatcaccaaaagtacatggacacc
tacttgaaaccataccctggctactacttcacaggtgacggtgctgcgcgtgatcatgat
ggctactactggatccgtggccgtgtggatgacgttgtcaatgtgtcgggacatcgtttg
tctacagccgagattgaagctgctttgatcgaacaccacggtgtttctgaatcggctgtg
gttggtatcaatgatgacttgaccggtcaggctgttgttgcgtttgttgcgttgaaggac
gaagttgccgatgccatcaatggcaacgagacttctgaggaggcgttcgctttgcgtcgt
gagttggtgttggtggttcgtaaagagattggaccatttgcggcaccaaagtctgtgatc
attgtccaggacttgccaaagacacgttctggtaagatcatgcgccgtatcttgcgtaag
atctcgtcaaatgaagctgaccagttgggtgacatcctgacattggctaacccacaatct
gttgcgggtatcattgactcgttcgctgcgcaatttggcaagaagtaa

DBGET integrated database retrieval system