KEGG   Clavispora lusitaniae: CLUG_01408Help
Entry
CLUG_01408        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
clu  Clavispora lusitaniae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:clu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:clu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:clu00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:clu00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:clu00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 250 aa AA seqDB search
MAHKLIVLRHGESQWNHENRFCGWIDIPLSAKGEQEAQHAGELIKKYNIKPDIMYTSMLQ
RSIKTGNIILETLGRSWIPEIKTWRLNERHYGSFQGRDKTEVFNEYGKEKFQYYRRDFHA
IPPRSDVDEDTSVDERYANLDRSEIPTGESLELTMARLIPFVSKEIVEQSLLTENKTVLV
VTHGSIVRSLIKHFDNVSDADISKINAPTGVPLVFELDQDGHLARPHYYLDEELAKKGMA
KVAMEGQQKL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataaacttattgtccttcgccacggtgaatcgcaatggaaccacgaaaatcgc
ttctgcggctggattgacatccctctttcagcaaaaggcgaacaagaggcacagcacgca
ggcgagttgatcaaaaagtacaacatcaagccggacattatgtacactctgatgctccag
cggtcgatcaaaacggggaatatcatattggaaacgctcggcaggctgtggattccggaa
atcaaaacatggcggctcaatgagcgccactatggcctgtttcaaggccgtgacaagaca
gaagtctttaatgagtatgggaaagagaaattccagtactatagacgagacttccacgca
attccacctaggctggatgtggacgaagatacctcggtggacgagcggtatgctaactta
gaccggtccgaaatcccaactggcgagtcgcttgaattaaccatggcacgcctcattcca
tttgtgtccaaggagattgttgagcagctgctcttgactgaaaataaaaccgttttggtg
gtgacgcatggatcaatcgtacgcagtttgatcaagcattttgataatgttagcgatgca
gacatcagcaaaatcaatgcgcctacaggtgtgccgcttgttttcgaacttgaccaagat
ggccacttggcgcggccacactactacttggatgaggaattggcgaaaaagggcatggct
aaagtggcaatggagggtcaacagaagttgtaa

DBGET integrated database retrieval system