KEGG   Clavispora lusitaniae ATCC 42720: CLUG_01408Help
Entry
CLUG_01408        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00010  Glycolysis / Gluconeogenesis
clu00260  Glycine, serine and threonine metabolism
clu00680  Methane metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
clu01200  Carbon metabolism
clu01230  Biosynthesis of amino acids
Module
clu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
clu_M00002  Glycolysis, core module involving three-carbon compounds
clu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLUG_01408
  Energy metabolism
   00680 Methane metabolism
    CLUG_01408
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLUG_01408
Enzymes [BR:clu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CLUG_01408
Membrane trafficking [BR:clu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CLUG_01408
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CLUG_01408
  Exosomal proteins of melanoma cells
   CLUG_01408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 DMRL_synthase
Motif
Other DBs
NCBI-GeneID: 8498735
NCBI-ProteinID: XP_002617949
UniProt: C4XZM6
AA seq 250 aa AA seqDB search
MAHKLIVLRHGESQWNHENRFCGWIDIPLSAKGEQEAQHAGELIKKYNIKPDIMYTSMLQ
RSIKTGNIILETLGRSWIPEIKTWRLNERHYGSFQGRDKTEVFNEYGKEKFQYYRRDFHA
IPPRSDVDEDTSVDERYANLDRSEIPTGESLELTMARLIPFVSKEIVEQSLLTENKTVLV
VTHGSIVRSLIKHFDNVSDADISKINAPTGVPLVFELDQDGHLARPHYYLDEELAKKGMA
KVAMEGQQKL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataaacttattgtccttcgccacggtgaatcgcaatggaaccacgaaaatcgc
ttctgcggctggattgacatccctctttcagcaaaaggcgaacaagaggcacagcacgca
ggcgagttgatcaaaaagtacaacatcaagccggacattatgtacactctgatgctccag
cggtcgatcaaaacggggaatatcatattggaaacgctcggcaggctgtggattccggaa
atcaaaacatggcggctcaatgagcgccactatggcctgtttcaaggccgtgacaagaca
gaagtctttaatgagtatgggaaagagaaattccagtactatagacgagacttccacgca
attccacctaggctggatgtggacgaagatacctcggtggacgagcggtatgctaactta
gaccggtccgaaatcccaactggcgagtcgcttgaattaaccatggcacgcctcattcca
tttgtgtccaaggagattgttgagcagctgctcttgactgaaaataaaaccgttttggtg
gtgacgcatggatcaatcgtacgcagtttgatcaagcattttgataatgttagcgatgca
gacatcagcaaaatcaatgcgcctacaggtgtgccgcttgttttcgaacttgaccaagat
ggccacttggcgcggccacactactacttggatgaggaattggcgaaaaagggcatggct
aaagtggcaatggagggtcaacagaagttgtaa

DBGET integrated database retrieval system