KEGG   Clavispora lusitaniae: CLUG_01411Help
Entry
CLUG_01411        CDS       T01149                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
clu  Clavispora lusitaniae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:clu01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:clu00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 549 aa AA seqDB search
MAYTKIDVDQEEQFFQNQVAEIKRWWAQPRWKKTKRIYTAEEIAAKRGTLKIDYPSSNQA
KKLYATLEERDRTKTVSFTFGALDPIHVSQMAKYVDTIYVSGWQCSSTASTSNEPSPDLA
DYPYDTVPNKTEHLWFAQLFHDRKQRSERLSMTKEQRAKTPYIDFLRPIIADADTGHGGL
TAIIKLTKLFIERGAAGIHIEDQAPGTKKCGHMGGKVLVPVQEHINRLVAIRASADMCGS
DLLAVARTDSEAATLITSTIDHRDHYFIAGSTNPDTPDLATLMAEAEAKGIYGERLAAIE
ADWTKNANIKLFSEAVIDAIKESSLPDKQKAISEFTRQVNPLSETSHKEARRIARSILGK
DIYFNWDVSRTKEGYYRYIGGTQCAVMRGRAYAPYADLIWMESALPDYDQAKEFAAGIKS
KYPDQWLAYNLSPSFNWNSAMSAADQETYIQRLGKLGYVWQFITLAGLHTTALAVDTFAK
NYAEIGMKAYGQQVQKPEIESGVEVVKHQKWSGAEYIDSLLRMVSGGVTSTAAMGAGVTE
EQFKEKGKL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcctacactaagattgacgtcgatcaagaagaacagttcttccaaaaccaagttgct
gaaatcaagcgctggtgggcacaaccccgctggaagaaaaccaagcggatctatactgcc
gaggagattgctgctaagagaggaactctcaaaatcgactacccttcgtcgaatcaagcg
aagaagttgtacgcgactctcgaagagcgtgaccgcaccaagaccgtgtccttcactttc
ggtgctttggaccctatccatgtttcgcaaatggccaagtacgtggacacaatttacgtt
tctggttggcaatgttcatcgactgcgtccacttcgaacgagccttcgcctgacttggcc
gactacccatacgacactgtgcccaacaagaccgagcacttgtggtttgcgcaacttttc
cacgacagaaagcagagatcggagcgtttgtccatgaccaaggagcaaagagcaaagacg
ccgtacattgactttctccgtcccatcattgctgatgctgatacaggtcacggtggattg
actgccatcatcaagttgaccaagttgtttattgagcgtggtgctgctggtatccacatt
gaggaccaggctccaggtaccaagaagtgtggccacatgggtggtaaggtgttggtccct
gttcaggagcacattaaccgtcttgtggcgatccgtgcgagcgcagacatgtgtgggctg
gacctcttggctgtggcacgtacagactcggaagctgccacgttgatcacctcgaccatt
gaccacagagaccactactttattgctggctccaccaacccagacaccccagacttggcc
actttgatggccgaggcagaggccaagggcatctatggcgagcgtttggctgctatcgag
gcagactggacgaaaaatgccaacatcaagttgttctctgaggctgtgattgatgccatc
aaggagtcttctttgccagacaagcagaaggccatttccgagttcactcgccaagtgaac
ccattgtcagagacctcgcacaaggaggccagaagaattgcccgctccattttgggcaag
gacatttacttcaactgggacgtttcccgtactaaagaaggatactaccgttacattggt
ggaacccagtgtgctgtgatgcgtggaagagcttacgctccttacgctgacttgatttgg
atggagtctgctttgccagactacgaccaagccaaggagtttgctgcaggtatcaagagc
aagtaccctgaccaatggcttgcctacaacttgtctccatctttcaactggaactcggct
atgagcgccgcagaccaggagacttacatccagcgtctcggtaagttgggctacgtctgg
caattcatcaccttggcgggcttgcataccaccgctttggccgtggacacttttgccaag
aactacgctgagatcggtatgaaggcctatggccaacaggttcaaaagcctgaaatcgag
agcggtgttgaagtagtcaagcaccaaaagtggtctggtgctgagtacattgacctgttg
ttacgtatggtgtctggtggtgtcacttcgactgctgctatgggtgctggtgtgactgag
gagcagttcaaggaaaagggcaagttgtaa

DBGET integrated database retrieval system