KEGG   Clavispora lusitaniae: CLUG_01470Help
Entry
CLUG_01470        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
clu  Clavispora lusitaniae
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:clu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MTEPSYEDLEKEISIDDIDFSDLEAKYAVNADLGLETYVVVDGAPKAPSSKAPLLEKVLR
KFLSKAGELVEGEAGVFLPIEDNMTKGYLFAQFKTPEMATAAVQQLNGKPLDAKHRLFVN
RFSDIEKYCTEGSVPSTFVEPEIPPQKSFGYLKSWLQDESGRDQMAMHFSDTVGVYFSNK
KNDPKAVTEPRKGFTSKYAKFSPKGTYLFSIHPQGVQSWGGEKFEKINKFVHPQVRLIDF
SPSEKYMVTLSPTGITAPESAAEAKEFPFGPESEGHKLVIWDLATGEPARTFALPPHLED
QKEMPWPLVKWSFDDKYCCRQGPDALAVYETPSFQLLDKKLVKVDGIVDFEWAPAGVKLS
GSRDEEGEHILSYWTPETPN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaccttcttacgaggatctcgagaaagagatctctatcgacgatattgacttc
tctgacttggaggcaaagtatgctgtaaatgctgatcttggcttggagacttatgttgtg
gttgacggtgcaccaaaagcacctctgtccaaagctcctttgttggaaaaagttttgaga
aagttcttgagcaaggccggtgaacttgttgagggcgaggcaggtgtttttcttcctatt
gaagacaacatgaccaagggttaccttttcgcccagttcaaaaccccagagatggccaca
gccgctgtgcaacaattgaacggaaagcctttggatgctaaacacagattgtttgtgaac
agattttccgacatcgaaaagtactgtactgaaggtagtgttccatcaacgtttgtggaa
cctgaaattcctcctcaaaagtcatttggttacttgaagtcttggttgcaagatgagagc
ggaagggaccagatggccatgcacttttcagacaccgtcggagtttacttcagtaacaaa
aagaacgatccaaaggcagttacagagccaagaaagggtttcacatcgaagtacgccaag
ttttcgccaaagggcacatacttgttttccattcaccctcaaggtgtccagtcttggggc
ggagagaagttcgagaagattaacaagttcgtgcacccgcaagtccgcttaatcgatttc
tctcctagcgagaaatacatggttacattgtctccaactggtattacagcaccagaaagt
gctgcggaggccaaagaattccccttcggacctgagtcagaaggccacaagttggtcatt
tgggacttggcgactggggaaccagctagaacttttgctttgccacctcacttggaagac
caaaaggagatgccatggccactcgtcaaatggtcgtttgacgacaagtactgctgtcgt
caaggtcctgatgctttagctgtgtacgaaactccaagctttcaattgttggacaagaaa
ttggtcaaggttgatggtattgttgacttcgaatgggctcctgctggtgttaagctttcg
ggctcgagagatgaagaaggtgaacacatcttgtcttactggactccagagactcctaac
taa

DBGET integrated database retrieval system