KEGG   Clavispora lusitaniae: CLUG_01484Help
Entry
CLUG_01484        CDS       T01149                                 

Definition
similar to MAP kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CLUG_01484
Protein kinases [BR:clu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CLUG_01484
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CLUG_01484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 379 aa AA seqDB search
MDKDQPDMSHVQAYPYQAQQKASPPVQPEGSKSVTFNVSDHYQILEVVGQGAYGMVCSAI
HKPTQQKVAIKKIEPFGRSMLCLRTLRELKLLKNFNHENIISILALQRPASYEDFSEIYL
IQELMETDLHKVIRTQKLSDDHIQYFIYQTLRALKALHSANVLHRDLKPSNLLLNSNCDL
KICDFGLARSVASSEDNFGFMTEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEMLS
GRPLFPGRDYHNQLWLIMEVLGTPNSEDYYNIKSKRAREYIRSLPFCKKVPLSELFGSIP
NVNPLAINLLEQLLAFNPSKRITVEMALQHPYLKIYHDPNDEPVCEPIPDDFFDFDRRKD
ELSISDLKKMLYDEIMKPL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagaccaacccgacatgctgcatgtgcaagcttacccataccaggcacagcaa
aaggcttcaccgccagtacagcctgaaggttccaaatctgtcacgtttaacgtttcggat
cactaccagatactcgaagtggttggccaaggcgcgtatggaatggtgtgtctggcaata
cacaaaccaacacaacagaaggtggcgatcaagaaaatcgaaccctttggtcgtctgatg
ctttgtttgcggacgctccgagagttgaagcttttgaagaacttcaaccacgaaaatatc
attagcatcttggcgttgcagagaccagcttcatacgaagatttctccgagatctaccta
attcaggagctcatggaaactgatttgcacaaggtgatcaggactcagaaactcagcgac
gaccacattcaatatttcatttaccagacactcagagccttgaaggctctccactcggca
aatgtgctccaccgtgacttgaaaccttcaaatttacttctcaactccaactgcgactta
aagatttgcgactttggattggcccgttctgtggcgtcgtcagaagacaattttggtttc
atgactgagtacgtggccacaagatggtatcgtgcaccagaaatcatgctcaccttccag
gaatacacaacagcaattgatgtgtggagtgtgggatgcatcttagccgaaatgcttagc
ggacgcccgcttttccctggaagagactaccataatcagttgtggttgattatggaggta
ttgggtacgcccaacctggaggattactacaacataaagctgaaacgagcgcgcgagtac
attagactgcttcccttctgtaagaaagtgccattgagcgagttgtttggcctgatcccc
aatgtgaacccgttggcaattaatcttttggaacaacttcttgccttcaacccatccaag
agaatcactgttgaaatggccttacaacatccatacttgaaaatataccacgaccctaat
gacgagccagtgtgcgagcctattcccgacgatttctttgactttgatcgtcgcaaggac
gagttgtccatcagcgacttgaagaaaatgctttatgacgagatcatgaagcctctttaa

DBGET integrated database retrieval system