KEGG   Clavispora lusitaniae: CLUG_01495Help
Entry
CLUG_01495        CDS       T01149                                 

Definition
similar to 2-oxoglutarate dehydrogenase complex E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
clu  Clavispora lusitaniae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLUG_01495
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLUG_01495
  Amino acid metabolism
   00310 Lysine degradation
    CLUG_01495
Enzymes [BR:clu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CLUG_01495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 436 aa AA seqDB search
MLSRTIRSSMRRMPVMKTGVKVTPAVMARSLHFKAPMVAAQHRMVSPMMTFTRLASTTVK
VPEMAESITEGTLASFNKEVGDYVDVDELVATIETDKIDVEVNAPVAGTITELLVAVEDT
VEVGQEIIKIEEGAAPEGQKAAPKEEAKEEKKEEPKKEETKKEEPKKEEPKKEEPKKETK
KETKKDSKSASQESSPASFNAFSRHEERVKMNRMRLRIAERLKESQNTAASLTTFNEVDM
SNLMEMRKLYKDEVLEKTGIKFGFMGAFSKACTLASKEIPAVNASIENNDTMVFRDYMDI
SIAVATPKGLVTPVVRNAESLSVLGIEQEIAALGKKARDGKLSLEDMTGGTFTISNGGVF
GSLYGTPIINMPQTAVLGLHGVKQRPVTVNGQIVSRPMMYLALTYDHRVLDGREAVTFLK
TVKELIEDPRKMLLSP
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgagaacaattagaagcagtatgcgccgcatgcctgtcatgaagactggtgtt
aaagtgaccccagccgttatggctagatccttgcacttcaaggcccctatggttgcagcc
caacacagaatggtttctccaatgatgactttcacaagattagcctccactaccgtcaag
gttcctgagatggctgaatccatcactgaaggtactttggcctctttcaacaaggaagtt
ggtgattatgttgatgttgacgagcttgttgcaactattgagaccgacaaaatcgatgtt
gaggtgaatgcgccagttgccggtactatcactgaattgttggtcgctgtcgaggatact
gttgaagtcggtcaagaaatcataaagattgaagaaggtgctgctccagaaggccaaaag
gctgctccaaaggaagaggcaaaggaggagaagaaggaggagcctaagaaggaggaaaca
aagaaggaggagcctaagaaggaagaaccaaagaaggaagaaccaaagaaggagactaag
aaagaaactaaaaaggatagcaaatctgccagccaagagtcttcccctgcatctttcaac
gccttttctagacacgaagaaagagttaagatgaacagaatgagattgagaatcgctgag
cgtcttaaggaatctcaaaacactgctgcttctttgaccactttcaacgaagtggacatg
tccaacttgatggaaatgagaaaattgtacaaggacgaagttttggagaagactggtatt
aagtttggtttcatgggtgcgttctctaaggcctgtactttggcttctaaggagatccca
gctgtcaatgcttccatcgagaacaatgacaccatggtctttagagactacatggacatt
tccattgctgtagctacaccaaagggtttggtcactccagtggtgagaaacgctgagtct
ctctcagtgttgggcattgagcaagagattgctgccttgggcaagaaagccagagacggc
aaattgtctttagaagacatgaccggtggtactttcaccatctctaacggaggtgtcttc
ggttctttgtacggtacccctattattaacatgccgcaaactgcagttttgggtttgcat
ggtgttaaacagagacccgttaccgtcaatggccaaattgtctctagaccaatgatgtac
cttgcattaacctatgaccacagagttttggatggccgtgaagctgttacattcttgaag
accgtcaaggagttgattgaggacccaagaaagatgttgttgtctccatag

DBGET integrated database retrieval system