KEGG   Clavispora lusitaniae ATCC 42720: CLUG_01495Help
Entry
CLUG_01495        CDS       T01149                                 

Definition
(RefSeq) similar to 2-oxoglutarate dehydrogenase complex E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00020  Citrate cycle (TCA cycle)
clu00310  Lysine degradation
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
clu01200  Carbon metabolism
Module
clu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLUG_01495
  Amino acid metabolism
   00310 Lysine degradation
    CLUG_01495
Enzymes [BR:clu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CLUG_01495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl GCV_H Biotin_lipoyl_2 TraF HlyD_3 RnfC_N RNA_pol_Rpc4 DUF719 RR_TM4-6 DDHD CPSF100_C Asp-B-Hydro_N DUF1510 Vfa1 Neur_chan_memb RP-C_C
Motif
Other DBs
NCBI-GeneID: 8498963
NCBI-ProteinID: XP_002618036
UniProt: C4XZW3
AA seq 436 aa AA seqDB search
MLSRTIRSSMRRMPVMKTGVKVTPAVMARSLHFKAPMVAAQHRMVSPMMTFTRLASTTVK
VPEMAESITEGTLASFNKEVGDYVDVDELVATIETDKIDVEVNAPVAGTITELLVAVEDT
VEVGQEIIKIEEGAAPEGQKAAPKEEAKEEKKEEPKKEETKKEEPKKEEPKKEEPKKETK
KETKKDSKSASQESSPASFNAFSRHEERVKMNRMRLRIAERLKESQNTAASLTTFNEVDM
SNLMEMRKLYKDEVLEKTGIKFGFMGAFSKACTLASKEIPAVNASIENNDTMVFRDYMDI
SIAVATPKGLVTPVVRNAESLSVLGIEQEIAALGKKARDGKLSLEDMTGGTFTISNGGVF
GSLYGTPIINMPQTAVLGLHGVKQRPVTVNGQIVSRPMMYLALTYDHRVLDGREAVTFLK
TVKELIEDPRKMLLSP
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgagaacaattagaagcagtatgcgccgcatgcctgtcatgaagactggtgtt
aaagtgaccccagccgttatggctagatccttgcacttcaaggcccctatggttgcagcc
caacacagaatggtttctccaatgatgactttcacaagattagcctccactaccgtcaag
gttcctgagatggctgaatccatcactgaaggtactttggcctctttcaacaaggaagtt
ggtgattatgttgatgttgacgagcttgttgcaactattgagaccgacaaaatcgatgtt
gaggtgaatgcgccagttgccggtactatcactgaattgttggtcgctgtcgaggatact
gttgaagtcggtcaagaaatcataaagattgaagaaggtgctgctccagaaggccaaaag
gctgctccaaaggaagaggcaaaggaggagaagaaggaggagcctaagaaggaggaaaca
aagaaggaggagcctaagaaggaagaaccaaagaaggaagaaccaaagaaggagactaag
aaagaaactaaaaaggatagcaaatctgccagccaagagtcttcccctgcatctttcaac
gccttttctagacacgaagaaagagttaagatgaacagaatgagattgagaatcgctgag
cgtcttaaggaatctcaaaacactgctgcttctttgaccactttcaacgaagtggacatg
tccaacttgatggaaatgagaaaattgtacaaggacgaagttttggagaagactggtatt
aagtttggtttcatgggtgcgttctctaaggcctgtactttggcttctaaggagatccca
gctgtcaatgcttccatcgagaacaatgacaccatggtctttagagactacatggacatt
tccattgctgtagctacaccaaagggtttggtcactccagtggtgagaaacgctgagtct
ctctcagtgttgggcattgagcaagagattgctgccttgggcaagaaagccagagacggc
aaattgtctttagaagacatgaccggtggtactttcaccatctctaacggaggtgtcttc
ggttctttgtacggtacccctattattaacatgccgcaaactgcagttttgggtttgcat
ggtgttaaacagagacccgttaccgtcaatggccaaattgtctctagaccaatgatgtac
cttgcattaacctatgaccacagagttttggatggccgtgaagctgttacattcttgaag
accgtcaaggagttgattgaggacccaagaaagatgttgttgtctccatag

DBGET integrated database retrieval system