KEGG   Clavispora lusitaniae: CLUG_01509Help
Entry
CLUG_01509        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
clu  Clavispora lusitaniae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CLUG_01509
Enzymes [BR:clu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CLUG_01509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1497 aa AA seqDB search
MSAEIGFVSASDAVARVEPSYSSARSVYTSVVNIMLYWLWILLVLVNNVVVVLPKKTVSI
LQTRFSVTLSLSSMLLYLAITVSLSYLIVRHKYLTRYSKNSPAKPEKSGSKLGVGVDYVN
GAKKKRGTDKSKNYLDEFLSAIKVFGYLERPVFHELTKSMTTQKLACDEILYLEEKLGFS
IVVEGTVQVFTKVEQGNGSPSEYTEQDSEDVLIIGEHRYQLLNEVKSGSPLSSLLSTLDL
FRSRNSLSSPINSPEKELLPKSKANGIERSASALSPNSIRPTEWGPQGFLWKDTPQFQNF
SLHSPSFGSTVPPSPDSPMGYLDQNNLPSLDYSSAQLPDIVVRPKKAGSKPEDSTATIAI
IPHSSFQRVQSKYPKATSHIVTMVLMRLHKVTMNAVHNYLGLTKEIFDCEVALNASTEES
KLPSYLYNGVIEKFNHYRTKQSGKLNSVDIFPKSTKKPRTLNRESSSRYVVLASRSKSSH
PGDLLSSVPLSRKPDLNKEPSSWNNEEEDSSRKHPRPKNNSSSESPLLPKLNKKHSHKPA
ENIRDRVFSDEREETEETSLRVAIVEIIFKMLGIEELALNMNLSAMTSGQLSANSSQIGL
SALMGGDNSVPISGEKYLSDFTTDATQKGLSFKSTSRPSSSLNLNSQKFYNTIYQTKDGS
RKVNGQDHLPDKRRESSSLSNGLNFASIKNAFSKYIEVKYYAANTTLVPQNSSDTGLYYV
IDGSLEVLLDFPSKSDSENSAPKTLYVVNSGELAGYLSTILGFKSLVGIKSGSSGAIVAH
ISKKDISAMMDKFYFLQLPVAAKLKSLLPGIIRTIDFALEWCHIPAGGILCNQGDLANGF
HIVLSGRFRVIRYKNLDTDDTSPLTPNTLIDNSNVHSHTVKSDDYEVLGEYGHGESVGEV
EVLTASRRTNSLIAVRDSETARIPRALFEMLSMRIPSIMVKVTRIVADRAIQMSKNEKYA
TAVATVTSSSVSKINSDYKTITILPTVNGLPVREFSERLVHAMKAIGRKVIALDQASILT
HLGRNAFDERLARLKLSGFFAFLEEEYDTVIYVCDTPLKSNWTSTCISQGDCILLLADAE
DDECATSAGDYEKVLLKLKTTARTELCLIHPEKSVFPGSTSIWLKNRLWVHGHHHIQMEL
SKDNAVNNVKKKGNILSELALKLSSKANPNIKLKFENVKSRAIASLVRLNERVNYTEETS
AVHKNDFLRLARILSNQSVGLVLGGGGSRGISHVGVVTALEKHGIPVDMIGGTSIGSFVG
GLYAKEYNSVSIYGMTKKFSRRIGSIWRSILDLTYPVTSYITGYEFNRGIWKVFGYHQIE
DFWIRYFCNSTNITNSTMEIHETGYAWRFIRASMSLAGLLPPITFNGSMLLDGGYLDNLP
VLEMKNRGAKYIIAVDVGSIDDRTPMNYGDTLSGFWVLLNRINPFSKHPNVPNMMEIQLR
LAYVASVNALEMAKRTPGVIYLRPPIDDYATLDFLKFDEIYNVGLAYADKVLTKWES
NT seq 4494 nt NT seq  +upstreamnt  +downstreamnt
atgctggctgaaataggttttgtttcagcttccgatgccgtcgcaagggtggagccttct
tactcttcggctcgctcggtttatacttccgttgtgaacatcatgctctactggctatgg
atattacttgtgctagttaacaacgtggtggtcgttctcccgaagaagacagtatcgata
ctccaaacacgcttcctggtgacgttgtcccttctgctgatgcttctctatcttgcaatt
actgtttcactcagttacttaattgtgcgacacaaatacctcacccgctactcaaaaaac
tccccagcaaaacccgagaaatcaggtctgaaacttggagtgggtgtggactatgttaat
ggtgcaaaaaagaagcgtgggacggacaaatcaaagaactacttggatgagtttctcagc
gccatcaaggtgtttgggtacttagaacgacccgttttccacgaacttaccaagagtatg
actactcaaaaactcgcttgtgatgaaattctctatttggaggaaaagctagggttttcc
atcgtggtagaaggaacagtacaagttttcacaaaggtagaacagggcaatggatcaccg
ctggagtacactgagcaagatctggaagatgtcttgattattggggagcatagataccag
ctattgaatgaggtcaagagcggctcgccattgtcttcgttactaagcaccttggatctt
ttcagatcacgaaattcattgagctcccctatcaattctcccgaaaaagaattattaccc
aagctgaaagcaaatggtattgaaaggtcggcctcagcattatcacccaattcaataaga
ccaacggagtggggccctcaaggtttcctctggaaggatacaccccaatttcaaaatttt
tcccttcattccccttcctttggctcaacagttccaccatctcctgatctgccaatggga
tatttggatcaaaacaacttgccttcactagattattcgtctgctcaacttccggatata
gttgttcggccaaaaaaggctggctctaaacctgaggattctacggcaacaatcgcaata
atccctcatctgtcatttcagagagtccaatcgaaatatcctaaagccacatctcatatc
gtgactatggtgcttatgaggttacacaaagtgaccatgaatgctgtccataactacttg
ggcttaacaaaggagatctttgactgtgaagtcgcattgaatgcttcaactgaagagagc
aaactacctagttatctttataacggtgtaattgagaaattcaatcactaccgtacgaag
caatctgggaaacttaactctgttgatatatttccaaaatcgacaaagaaaccccgcact
ttgaatagagaaagctcatcaagatatgttgtgttagcatcgcgttccaaatcatcgcat
cctggagatttgctctcctcagttcctttatctagaaaacctgaccttaacaaggaacca
agtctgtggaataatgaagaggaagactcgtccaggaaacatccacggccaaagaacaat
agttctagtgaaagccctcttcttcccaaattgaataagaagcatagtcataagcctgcg
gagaatattagggaccgtgtattctcagatgagagagaagaaactgaggaaacttcgctt
cgtgttgccatagttgaaattattttcaaaatgctcggaatcgaagagttagctttgaac
atgaacttatctgcaatgacgagtggccagctttctgccaattcatctcagattggattg
tctgcattgatgggtggcgataattctgttccaataagtggcgaaaagtacctttcagat
tttactacagacgcaacgcagaaaggtttatcattcaaatcaacatcgcgcccatcatcg
tccttaaacttgaactcccagaagttttataacacaatttaccagactaaggatggctca
agaaaagtaaatggtcaggaccatttacctgataagaggagggagtcgagcagtttatca
aacggtctcaattttgcttccataaagaatgccttcagcaagtacattgaagtgaaatat
tacgcggcgaatacaactttagttccccaaaattcttctgatacgggattgtactacgtg
atagatggtagtttagaagtgcttcttgatttcccatccaagtctgattctgaaaattcg
gctccgaaaacattatatgtagttaattctggagaattagctggctacttgagtaccatt
ctcgggttcaaatcattagtgggcattaaaagtggaagcagtggtgctattgttgcgcat
atttcaaagaaggacatttctgctatgatggataaattttatttcttgcaacttcctgtt
gccgcaaagctcaagtcgttgcttccgggtataattcgtacaattgactttgcgctagag
tggtgtcatattcctgctggtggaattttgtgcaatcagggagaccttgcaaatgggttt
catatagtattgagtggtaggtttcgtgtcattcgctacaaaaatttggatactgatgat
acatctcctctcactccaaatactctcattgacaattcaaatgtgcattctcatacagtg
aaaagcgatgattatgaagtgctaggtgagtatggtcatggtgagtctgtgggagaagta
gaggtcttgacagcttccagaagaacgaactcattgattgcagtcagagactccgagacg
gctagaattcccagagccttgtttgaaatgttgtcaatgagaattccgtcgattatggtt
aaggtgacacgtatcgttgcggatcgtgccatacaaatgagcaagaacgaaaagtatgca
actgctgttgcaaccgtcacatcatcctctgtatctaagatcaacagtgactataagact
atcacaatcttaccgacagtcaatggtcttcctgttagagaattttctgagcgattagtg
catgctatgaaggctataggtcgtaaggttattgcacttgatcaggcatctatcctcaca
catcttggacgaaacgcttttgacgagaggttagcaaggctcaaactttctggattcttc
gcctttttggaagaagaatatgatacagtcatttacgtgtgtgacactccgttgaaatca
aactggacatcaacatgcatctctcaaggagattgtattttgttactagctgatgccgaa
gatgatgaatgtgcaacaagtgctggtgattacgaaaaggtccttcttaaactcaaaacc
actgctcgtacggagttatgtttgatacatccagagaaatctgtttttcctggatccaca
agtatctggctcaaaaacagactctgggtacatggacatcatcacattcaaatggaatta
ctgaaagacaatgcagttaataatgtgaagaaaaagggcaacattctttcggaattagcc
ctcaagttgagcagtaaagctaatccaaacattaaattgaagtttgaaaacgtgaagtcc
cgggcaattgcctcgttagtcagacttaatgaaagagtcaactatacggaggaaacttct
gctgttcataagaatgactttttgcgattagcacgaattctttccaatcaatccgtcgga
cttgtcttgggtggaggaggatcaagaggtatatcgcatgttggtgttgtaacggcgtta
gaaaaacatggaattcctgttgatatgataggtggtacatctattggctcatttgtgggc
ggtctttatgcaaaggagtataatagtgtttcgatttacgggatgactaagaaattctcc
aggcgaattgggtctatttggagatctattctagatttgacataccctgtgacttcctat
attactggttatgaatttaacagaggcatatggaaggtctttggatatcaccagattgaa
gatttttggattagatacttttgcaactcgacgaatatcacgaattctacaatggaaatt
cacgaaacggggtatgcttggagatttattagagcatcgatgtcattggctggcttactt
cctcctataactttcaatggctctatgcttttagatggtggatacttggataaccttcca
gtattggagatgaagaataggggagctaagtacatcattgccgtcgatgttggatcgatc
gatgatagaactccaatgaattatggagataccttgtcaggtttctgggtccttttaaac
agaataaatccattttctaagcatcccaatgttccaaatatgatggaaattcagcttaga
ttggcatatgttgctagtgtcaacgctctcgagatggcaaagagaactccaggtgtcatc
tatcttcgtccacctatcgatgactatgctactcttgattttttgaaattcgacgagatt
tacaacgttgggctagcgtatgccgataaagtgctcactaaatgggagtcctga

DBGET integrated database retrieval system