KEGG   Clavispora lusitaniae: CLUG_01525Help
Entry
CLUG_01525        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
clu  Clavispora lusitaniae
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:clu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 635 aa AA seqDB search
MKFQKLLLFGAGVLAWSPTNNYAPAKVDCPSGSLVRAADKISDDESSWVKERNKVTDKNL
ESFLQKADLDDFDVSSFLSNTSDGRSIKIGIAFSGGGYRAMLAGAGELSALDNNTVGASS
HGLGGLLQSATYLVGLSGGNWLVGSLVMNNWTSVQEIVDENKIWNLEHSIVNYGGWNPIK
AYNYYDGIYDDVKDKEDAGFELSITDTWGRALSHQFFPESTNYGNSLLWSQIQDMDDFVN
HDMPFPIVVADGRTPGTTIISGNSTVFEFNAFEMGSWDPSLYQFTDVRYLGTKVKDGKPL
NNTCIGGFDNAGFVMGTSSSLFNQFVLQINTTSLSSTLKSIITSLLDHVSKDEDDIAIYE
PNPFKGTDEASVESIVKNDTLYLVDGGEDLQNIPLHPLIQPKRGLDVIFAYDNSADTNES
WPNGASMVATYERQFLKQANSTIFPHVPDINSFINLNLTAKPTFFGCDAKNLTSLLPDGA
DQSAVYDSPLIVYTANRPFTYYSNTSTFKLSYEDDEKFGMIKNGFEVASRLNGTLDKEWS
TCVACAIIRREQERQGVEQSEQCKKCFDTYCWDGSIDTSEPGVNFTSTGSTSGPEENGNR
TVSFGYSLVRSDDNYGLLKIVLLASLISVVSSFSF
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccaaaaactcttgctttttggagccggggtccttgcatggtctcccacaaac
aattacgccccagctaaggtcgattgcccatccggaagcttggttagagctgccgataaa
atctccgatgatgagtcttcctgggtcaaggaaagaaacaaggtgactgacaagaatcta
gaatcattccttcaaaaagctgatttggacgacttcgatgtgtcaagtttcctttcgaac
acttcggacggtagatctatcaagatcggtattgcattctccggaggaggctatagagct
atgttagcaggagcaggcgaactttccgctctagacaacaacaccgttggcgcctcctct
catggtttgggtggcttgcttcaatctgccacatatttagtggggttgtctggtggtaac
tggcttgtgggcagtttggtcatgaacaactggacgagtgtacaagagattgtggacgaa
aataagatctggaacttggagcattctattgtcaattacggtggatggaaccctatcaaa
gcttataattattatgatggtatctacgatgatgttaaagataaagaggatgcgggcttc
gaactttccatcaccgacacatggggtagagctttgtctcatcaattcttccctgaactg
actaattatggtaattctttactttggtctcaaattcaagatatggatgatttcgtcaac
catgacatgccttttccgattgttgttgcagacggcagaacgcctggtactacaatcatt
agtggaaactcgacagttttcgaattcaatgcattcgagatgggttcttgggacccttct
ttgtatcaattcactgacgtcagatacttgggtacgaaagtgaaagacggaaaaccattg
aacaatacttgcattggtggatttgataacgctggttttgtcatgggtacctcctcttcc
cttttcaaccagtttgttttgcagattaacactacttctctttctagtacactcaaaagt
ataatcaccagtttgttggatcatgtttcaaaagatgaggacgacattgctatctatgaa
ccaaatccatttaaaggaactgacgaagcttcagtagagagcattgttaaaaacgacaca
ttgtacttggtcgatggtggcgaagatttgcaaaatattccattgcaccctttgatccaa
cccaaaagaggtctcgacgtcatctttgcatacgacaactcagctgacactaacgaaagc
tggccgaatggagcatccatggtagcaacttatgagagacagtttttgaaacaagcgaac
tctaccattttccctcacgttcctgacatcaattcatttatcaatttgaatttgactgca
aaacctaccttctttggctgtgatgcgaagaacctcacttcattgctcccagatggcgct
gaccaaagtgctgtttatgactcgccgttgattgtttacactgccaacagaccattcacg
tactactctaacacatcgacattcaagctctcatatgaggatgacgagaagtttggaatg
ataaaaaatggttttgaagttgcttccagactcaatgggactttggacaaggaatggagc
acgtgtgttgcttgtgcaatcattagacgtgaacaagaaagacaaggtgttgaacaatct
gagcagtgcaagaagtgtttcgacacttactgttgggatggcagtattgacaccagtgag
cctggtgtgaatttcacaagcactggatccacttctggaccagaggaaaacggaaacaga
acagtaagtttcggctactccttggtaagatccgatgataactatggcttacttaaaatt
gttttgttggcttctttgatctcagttgtcagcagtttctctttctga

DBGET integrated database retrieval system