KEGG   Clavispora lusitaniae: CLUG_01537Help
Entry
CLUG_01537        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
clu  Clavispora lusitaniae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CLUG_01537
Translation factors [BR:clu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CLUG_01537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 271 aa AA seqDB search
MSWDDEDFDIPTSSKPAANSWEEEVEDEPLMDSWDVDEEAEAKKKKAEEEKKKAELKKKQ
EEAKAKKLAAKSGAPKLMEIDMVDEETRKELLRQAELEADLNNAADLFGGLGVADDVNAH
PREKLTIPVKKSSGFNKDTPLTEHPLFQPTNKQEFEKLRKTLGPILSGLAEDSLMNYSSS
LAIDLIRDLVQPLSVENVRKVISTLNVTLKDKERQERQARLQKSGGTATGGAGKKKAKPL
VKTNVNNTAFKKDVYDDMDANYDDFGDDDFM
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggacgacgaagattttgatattcctacaagcagcaaaccagctgccaactct
tgggaagaagaagttgaagatgagcccttaatggactcgtgggacgttgatgaagaagca
gaggctaagaagaagaaagctgaggaagagaagaaaaaggccgagttgaagaaaaagcaa
gaggaggccaaagctaagaagttggcggcaaagtcaggtgccccaaaacttatggaaatt
gacatggttgatgaggaaacaagaaaagagttgttgagacaagccgagttggaagctgac
ttgaacaatgctgctgacttgtttggaggtttgggcgttgctgatgacgtgaatgctcat
ccaagggagaagttgactatcccagtgaaaaagagctcgggtttcaacaaagatacaccc
ttgactgaacacccattgtttcagccaacaaacaagcaagagttcgaaaagttgagaaag
actttaggcccaatcttgagcgggttagccgaagattctttgatgaactactcctcttcc
ttggctattgatttgatcagagatcttgttcaacctttgagcgtggaaaatgttagaaaa
gtcatttctactttgaatgtcacacttaaggacaaggaaagacaagaaagacaagctaga
ttgcaaaagagtggtggcactgccacaggaggtgcaggtaagaagaaggcaaaaccattg
gtgaagaccaatgttaacaacacagctttcaagaaggacgtctacgatgatatggacgca
aactacgacgactttggcgatgacgacttcatgtaa

DBGET integrated database retrieval system