KEGG   Clavispora lusitaniae: CLUG_01659Help
Entry
CLUG_01659        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
clu  Clavispora lusitaniae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:clu00760]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 242 aa AA seqDB search
MIKVAVIVIDVQEDFLPPNGTLAVPDGRDVISPICNILNAGRYPWSAVAITQDWHPETHC
SFASNHNVEPYSELEFKHPLGEKNGTTCEVKTQTQTVWPIHCVQGSPGAQVEKQVWEHFE
RIRKHLPSAVVKKGYLEDREYYSCFCDCWKLHRTEMTEFLQENQITDVVFVGLAYDYCVL
HSATDCSESGFNTYVIKDCCRSVFPDRIAQTEKQYSDAGVRLFDDADSLLKHFEECSRRH
AG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggtggcggttatcgttattgatgtccaggaagattttctccctccaaacgga
acgttagcagttcccgatggtcgcgatgtgatctctcccatctgcaacatccttaatgct
ggaagatacccgtggctggctgtggcgataacccaggattggcatcccgaaacccattgc
ctgtttgcatcaaatcataatgtcgaaccgtattcagaacttgagttcaaacatcctctc
ggagagaaaaacggcacaacatgtgaagtgaagacacaaacgcagacagtttggccaatc
cactgcgtacaaggtctgccgggggcacaagtggagaaacaagtatgggaacattttgag
cgcatccgcaaacatcttccctctgcagttgtgaagaaaggctacttggaggacagagag
tactatctgtgtttctgtgactgctggaaattgcatagaacagagatgacagaattcctt
caagaaaatcaaatcaccgatgttgtgttcgtgggtcttgcttacgactactgtgtactc
cactcggccacagactgtctggaatctggcttcaacacatatgtgatcaaagactgctgc
cgcagcgttttcccagaccgcattgcccaaacagaaaagcaatatagcgatgcgggtgtt
cggctttttgatgacgctgatagtcttcttaaacatttcgaggagtgtagtagaagacat
gcgggttag

DBGET integrated database retrieval system