KEGG   Clavispora lusitaniae: CLUG_01659Help
Entry
CLUG_01659        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
clu  Clavispora lusitaniae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CLUG_01659
Enzymes [BR:clu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CLUG_01659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 242 aa AA seqDB search
MIKVAVIVIDVQEDFLPPNGTLAVPDGRDVISPICNILNAGRYPWSAVAITQDWHPETHC
SFASNHNVEPYSELEFKHPLGEKNGTTCEVKTQTQTVWPIHCVQGSPGAQVEKQVWEHFE
RIRKHLPSAVVKKGYLEDREYYSCFCDCWKLHRTEMTEFLQENQITDVVFVGLAYDYCVL
HSATDCSESGFNTYVIKDCCRSVFPDRIAQTEKQYSDAGVRLFDDADSLLKHFEECSRRH
AG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggtggcggttatcgttattgatgtccaggaagattttctccctccaaacgga
acgttagcagttcccgatggtcgcgatgtgatctctcccatctgcaacatccttaatgct
ggaagatacccgtggctggctgtggcgataacccaggattggcatcccgaaacccattgc
ctgtttgcatcaaatcataatgtcgaaccgtattcagaacttgagttcaaacatcctctc
ggagagaaaaacggcacaacatgtgaagtgaagacacaaacgcagacagtttggccaatc
cactgcgtacaaggtctgccgggggcacaagtggagaaacaagtatgggaacattttgag
cgcatccgcaaacatcttccctctgcagttgtgaagaaaggctacttggaggacagagag
tactatctgtgtttctgtgactgctggaaattgcatagaacagagatgacagaattcctt
caagaaaatcaaatcaccgatgttgtgttcgtgggtcttgcttacgactactgtgtactc
cactcggccacagactgtctggaatctggcttcaacacatatgtgatcaaagactgctgc
cgcagcgttttcccagaccgcattgcccaaacagaaaagcaatatagcgatgcgggtgtt
cggctttttgatgacgctgatagtcttcttaaacatttcgaggagtgtagtagaagacat
gcgggttag

DBGET integrated database retrieval system