KEGG   Clavispora lusitaniae: CLUG_01688Help
Entry
CLUG_01688        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
clu  Clavispora lusitaniae
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:clu00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 496 aa AA seqDB search
MSELSLKLLQAVDKHNGISNTLELDEFKSIDANALHASLTSLWAKDMVTFSKIENDLWVL
TKEAEDFLVSGSHEIRLLDEVLKSMEGLSLSDVNAKLGQVGKLGQGKAFKNGWIAKDGDK
LVAKVKELPKDNVVEQLKTIEATGNLSDKKELAELKKRKLISMTKIIGYKVEKAAKFALT
ITNYETDITSEMITSGSWKDAQFKSYNFNSEGVYPQSGALHPLMKVREEFRQIFFSMGFT
EMPSNQYVESGFWNFDTLFVPQQHPARDLQDTFYLKDPAVAKKPQDEKYLEDIKAVHQDG
KFGSIGYRYPWKEDESLRMVLRTHTTAISSAMLKELAKDPKPTRLFSIDRVFRNEAVDAT
HLAEFHQVEGVLAGYDITLGDLIGFMEDFFSKMGVDGLRFKAAYNPYTEPSMEIFAFHKG
LGKWVEIGNSGMFRPEMLEPMGLPKNLRVLGWGLSLERPTMIKYGVSNIRELLGHKVSLD
FIETNPAARLDDDLVG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagttgtccttaaaattattgcaggccgtggataagcataatggtatctccaac
actttagagttggatgaattcaagtccatagacgccaacgccttacatgcttcgttgacc
tctttgtgggccaaggacatggttactttcagcaaaatcgaaaacgatttgtgggttttg
acgaaagaagccgaagactttttggtttctggctcacatgaaatcagattgttggatgag
gtacttaaatccatggaaggcttgagtctttctgatgtgaatgccaagttgggccaagtg
ggcaaattgggccaaggtaaagctttcaaaaatggttggattgctaaagacggtgacaag
ttggtggctaaagtcaaggagttgccaaaggacaacgttgttgagcaattgaaaactatc
gaggctacaggtaacttgtctgacaagaaagaattggctgagttgaagaagagaaagttg
atcagcatgacaaagatcattggatacaaggttgaaaaggcagctaagttcgccttgacc
atcacaaattacgagacggatatcacttctgagatgatcacttctggctcttggaaggat
gctcaattcaagtcatacaatttcaactctgaaggtgtgtaccctcagtctggtgctttg
catccattaatgaaagtcagagaagaatttagacagattttcttttccatgggtttcacg
gaaatgccttctaatcagtacgtggaatctggtttctggaacttcgacaccttgtttgtc
ccccaacagcatccggccagagatttgcaagacactttttacttgaaggacccagccgta
gctaaaaaacctcaagatgaaaagtacttggaggacattaaggccgttcaccaagatgga
aagtttggttcgattggttacagatacccatggaaagaagacgagtcccttcggatggtt
ttgagaacccatacaacagctatttcttcggctatgttgaaggagttggctaaggaccca
aagcctaccagattgttctctattgatcgtgttttccgtaacgaggctgttgatgctact
catttggctgagtttcatcaagtcgaaggtgtccttgccggttatgacatcaccttgggt
gatttgattggctttatggaagatttcttctccaagatgggtgtcgacggtttgagattc
aaggccgcgtacaacccatacactgaaccatcgatggagattttcgccttccacaaaggc
ttgggtaaatgggttgagattggtaactcaggtatgttcagaccagagatgttggaacca
atgggcttgccaaagaacttgcgtgtgttgggctggggtctttcgttggagagacctacc
atgatcaagtatggtgtttcgaacatcagagaattgttgggccacaaggtttccttagac
ttcatagaaacaaacccagctgccagattggatgacgatttggttggttag

DBGET integrated database retrieval system