KEGG   Clavispora lusitaniae: CLUG_01732Help
Entry
CLUG_01732        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
clu  Clavispora lusitaniae
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:clu04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 737 aa AA seqDB search
MMNITFSTNKMYSYQARYLLAKSDFDLWAKVLSPDNVHRRQLIDQVVSTGIPELSDPEPV
SVTVKAFMENDLPQELIELLEKIILEPSPFNDNTSLQGLLILTAIKADPSRVANYVEKLD
KYDPTEIAPLCIDNDLFEEAFDVYDKFELRSEAMKVLVEDIMSLDRGEQYAEKYDTPELW
FQLGTAQLNGLRIPEAISSYVKSKNPSNFEQVIEIAERAGKEEELIPFLEMARETLREPI
VDNAVINCYASLNKLSEIEKFVAGPNVAVLEEIGDKLFEAKNYKAAKILYSNISKYSKLA
TTLVYLEDYQGAVDCARKASNTNVWKQVNSACIENKEFRLAQICGLNLIIDAEELPELVR
TYEYNGYFDEVISLFESGLGLERAHMGMFTELAILYSKYRPEKVMEHLKLFWSRINIPKV
LSACEDAHLYPELIFLYCHYEEWDNAALTMIDKSEVAFDHSSFKEIIVKVSNLEIYYKAI
NFYMSENPTLLVDLLSVLTPKLDLPRVVRMFVKSDNLPLIKPFLISVLDKNNSIVNSAYH
DLLIEEEDYKSLNSAIESETSNRFNSLDLAERLENHKIIFFRQISATLYTKNKKYNKAIS
ILKSDKLWADLIKTVTISKSTKLAHELLDYFVETGNHECFVALLYSSYDLVEFDYVLELS
WLHNLGNFIKPYEISIVYENRKKLDEVYDDLQKRKQAEEKDDEPATGQPLMITGGPVAQN
FTGLGYQPTGTGFGNAF
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatatcacattctctacgaataagatgtacagttatcaagctagatacttgtta
gctaaatccgactttgatttgtgggcgaaggtcttgtctccagacaacgtacacagaagg
cagcttatcgaccaagttgtgtcaacaggcatcccagaattgagtgatcccgagcctgtt
tccgttacagtcaaggctttcatggaaaatgacttaccacaagaattgattgagttgtta
gagaaaatcattttggagccttctccatttaacgataacacttctttgcaaggtttattg
atcttaacagcgattaaagctgacccatctcgtgttgcaaactatgttgagaaattggac
aagtatgatcccactgagatcgctccattgtgtattgacaacgacttgtttgaagaagct
ttcgatgtatatgacaaattcgaattaagaagcgaagctatgaaggtcttagttgaagat
atcatgtccctcgacagaggtgaacaatatgccgagaaatacgatactcctgaattgtgg
ttccaattgggtactgcgcaattgaacggcttacgtattccagaagctattagctcttat
gtcaagtccaagaaccctagcaacttcgaacaggtcatcgaaatcgctgaacgtgctgga
aaagaagaggaattgatcccattcttagaaatggctagagagacattgagagagccaatc
gttgacaatgctgtgatcaactgttacgcatctttgaacaagttatcagaaattgagaag
tttgttgctggccctaacgttgctgtcttggaagaaattggtgacaaattatttgaggct
aaaaattacaaggcggccaaaattttgtactccaatatttcaaagtactccaagcttgct
acaaccttggtttatttagaggattaccaaggtgctgttgactgtgccagaaaggcttcg
aacaccaatgtttggaagcaggtgaacagcgcatgtattgagaacaaggagttcagattg
gctcaaatctgtggtttgaacttaattattgatgctgaggagttacccgagttggttaga
acctatgagtacaatggttacttcgacgaggtaatttcgcttttcgaaagtggtttgggc
ttggagagagcacatatgggaatgttcaccgagttagctatcctctactctaaatacaga
ccggagaaggttatggaacatttgaaattgttctggtcaagaattaacattccaaaagtg
ttgagtgcttgtgaggatgcgcatttgtatcctgagttgatcttcttgtactgccactac
gaagaatgggacaacgctgctttgactatgattgataagtctgaagttgccttcgatcat
tcatctttcaaggaaatcatcgtgaaggtgtctaacttggagatatattacaaggctatc
aacttctacatgtctgagaacccaactcttttggttgacttattgtctgttttgacacct
aaacttgatttaccaagagttgtcaggatgttcgtcaagtcagacaacttgccattgatt
aagcctttcttgatttctgtgctcgataagaacaactctattgtcaacagtgcctaccat
gacttgttgatcgaggaggaggactacaagtcgttgaactctgccatcgagagtgaaact
agcaacagattcaactctcttgatttggccgagagattggaaaaccataagataatcttt
ttcagacaaatctctgccacattgtacaccaagaataagaagtacaacaaggcgatttcg
attttgaagagtgacaaattatgggctgacttgatcaagacagtgacaatttcaaagtct
accaagcttgcgcatgaactattggactactttgtggaaactggtaatcacgaatgtttt
gttgccctcttgtactcgagttacgacctcgtcgagtttgattatgtccttgagttgagc
tggttgcacaacttaggcaacttcattaaaccatatgaaatttccatcgtttacgagaac
cgcaagaagcttgatgaggtttacgatgacttgcagaagagaaagcaagcggaggagaag
gatgatgaacctgctactgggcagccattgatgatcactggaggtcctgttgctcaaaac
tttacagggttgggctaccaacctactggcaccggtttcggcaatgccttttga

DBGET integrated database retrieval system