KEGG   Clavispora lusitaniae: CLUG_01801Help
Entry
CLUG_01801        CDS       T01149                                 

Definition
similar to core region of GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
clu  Clavispora lusitaniae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CLUG_01801
Enzymes [BR:clu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CLUG_01801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 306 aa AA seqDB search
MLPTEANGKRKRGENFEDEDGKRDGQIDGVLPKEKEQRTDNHQHDQTDESGDQNDTKNGS
HHSNPLVDIPPRQRLLRQLTPLHIRAASPCTLNPPIDSDGLSWPSQGARDRLEQTPEEAK
AREQRIAGAVKTILTELGEDVTREGLLETPERYARAMMYFTKGYEDNIRDVIKRAVFEED
HDEMVIVRDIEIYSLCEHHLVPFFGKAHIAYIPNKRVVGLSKLARLAEMYSRRFQVQERL
TKQIAMALSEILKPRGVAVVIEATHMCMVSRGVQKTGSSTTTSCMLGCFRVQQKTRDEFL
TLLGRK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccacagaagccaatggtaagagaaaaagaggagaaaattttgaggatgaagac
ggtaagcgagatggacaaatagatggcgtcttgccaaaggaaaaggagcagagaacggat
aatcatcaacacgaccaaacagatgaatctggcgatcaaaatgacaccaaaaatggatct
catcattctaatcccctcgtggacattccaccgagacagaggcttcttcgtcaacttact
ccacttcatatccgtgccgcctcaccctgcactttaaacccacccattgatagtgatggt
ttactgtggccatcacagggggcccgtgacagacttgagcagacgccagaggaagctaag
gcacgtgaacagcgcattgctggagcagtgaagacaattttaactgaacttggagaagac
gttactcgggaaggtcttttggagacaccagagcgatatgcacgtgcaatgatgtacttc
accaagggctacgaagacaacattcgggatgtgatcaaacgggcagtattcgaagaagat
catgacgagatggtgattgtccgtgacatcgagatctactccttgtgcgagcaccatttg
gtgcccttttttggaaaggctcacattgcctatattcccaacaagagagtggttggactt
ctgaagcttgcacgtttggctgaaatgtatctgcggcgtttccaagtgcaagagcgtttg
acgaagcaaattgccatggcattgagcgagatcttgaaaccacgtggagttgctgtagtc
atcgaggctactcacatgtgtatggtgagccgtggtgttcaaaaaactggcctgtcaacg
acaacaagttgtatgttgggttgtttccgtgtgcagcaaaagacccgtgacgaattcttg
acgctcttgggacgcaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system