KEGG   Clavispora lusitaniae ATCC 42720: CLUG_01811Help
Entry
CLUG_01811        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00010  Glycolysis / Gluconeogenesis
clu00030  Pentose phosphate pathway
clu00051  Fructose and mannose metabolism
clu00052  Galactose metabolism
clu00680  Methane metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
clu01200  Carbon metabolism
clu01230  Biosynthesis of amino acids
clu03018  RNA degradation
Module
clu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLUG_01811
   00030 Pentose phosphate pathway
    CLUG_01811
   00051 Fructose and mannose metabolism
    CLUG_01811
   00052 Galactose metabolism
    CLUG_01811
  Energy metabolism
   00680 Methane metabolism
    CLUG_01811
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CLUG_01811
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLUG_01811
Protein phosphatases and associated proteins [BR:clu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLUG_01811
Messenger RNA biogenesis [BR:clu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLUG_01811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK UVR DAGK_cat Ribosomal_S11
Motif
Other DBs
NCBI-GeneID: 8499273
NCBI-ProteinID: XP_002618352
UniProt: C4Y0S9
AA seq 980 aa AA seqDB search
MAIEGVSFISLVTADPTKFKEACEFYRRLGFRLAKNYSKLSSSGAAVAHHPKLSSGLCTD
SIREVWLESFPLQNTDENGCVVPWQELRFYNGDHTAPLAPSTCLKILLSPSEVIEPVFAG
LEFFSPELGKVAEILGSKEVSQEDEKNPKAKRVLATDPLGNHVSFSNTSEGRVFNSTKEY
IDYRTQLLVKEEEAQEPAPAAPTAAKKKKIAVMTSGGDSPGMNAAVRAVVRAGIYLGCDM
FAVYEGYEGLVRGGDLLRRMEWDDVRGFLSFGGTNIGTARCMAFKERKGRLAACKNMVDA
GVDALVVCGGDGSLTGADLFRSEWPSLIDELAQNGDITEEKAEYHRHLTIVGLVGSIDND
MASTDATIGAYSSLERISEMVDYIDETASSHSRAFVVEVMGRHCGWLGLMAGLSTGADYI
FIPEKPPRHGEWQEELKKVCSRHRGYGKRNTTVIVAEGAIDDQLQPITSEHVKNVLVDMK
LDTRITTLGHVQRGGTAVAYDRLLATLQGVEAVHAVLESTPETPSPMIGILENKIVRQPL
VESVRLTKSVAEAIENKDFEKAMSLRDSSFANAYETYLSTAIHDDGTQLLPENERLNIGI
VHVGASSSALNATTRAAALYCLSKGHKLFAIQDGFSGLAHSGVVKELSWMDVDGWHNRGG
SEIGTNRSLPSESFGNVAYYMQRYQFNGLLILGGFEAFTALHELESHKHEYPIFNIPKVV
IPATVSNNVPGTEYSLGSDTCLNQLVNYCDAIKQSASSTRRRVFVVEVQGGNSGYVACYA
GLVTGAMAVYRPEQNINLKSIREDIDLLTAVFKNDRGEDKNGKIVIRNEHASSVYSTELL
ADIFRDDSHGRFETRTAIPGHVQQGFTPSSMDRSYAVRFAVESVKYIEEWSRKAFNTIHR
DHTSHHSVNNIKMIELMRKEEKASVVIGIQGASLKFSDVNDLYEKDADVSLRKGRTVHWS
RLAEVGDILSGRLMLREGKA
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgaaggcgtcagctttatttcgctcgtcaccgcagaccccaccaaattcaag
gaggcctgcgagttttaccgccgcttgggtttccggttggccaaaaactactccaagctt
tcgagtagcggtgctgccgttgcccatcatccaaagttgctgctgggactttgcacagac
tcgattcgtgaagtctggttagagagcttccccttgcaaaatactgatgaaaacggctgc
gttgttccatggcaagaattacgcttttacaatggcgaccacaccgcgccattggcacct
agtacgtgtctcaagatcctcttatcgccactggaggtcatcgagcctgttttcgcgggg
cttgagtttttcagtccggaattgggcaaggtggctgagatcttaggttcgaaagaagtt
tcgcaagaggacgaaaagaaccccaaggcaaagcgtgttttggccacagacccgcttgga
aaccacgtaagcttcagcaacacttctgaaggccgtgttttcaacagcaccaaagaatac
attgattaccgcacacagcttcttgtcaaggaggaagaggcgcaagaacctgcccctgcg
gcacccacagctgctaagaagaagaagatcgcagtcatgacttccggaggagactcgcct
ggtatgaatgccgcagttcgtgctgtggttcgggccggtatttacttgggctgcgacatg
tttgccgtgtacgaaggttacgagggtttggtacgcggaggtgacttgttgcgccgcatg
gaatgggacgatgtgcgtggtttcctttcctttggtggtacgaacatcggaacggcgcgc
tgtatggctttcaaggaaagaaagggccgcttggctgcgtgcaagaacatggtggacgct
ggcgtggatgcgcttgtggtttgcggtggagatggttctttgaccggtgccgacttattc
cgttccgagtggccttctcttattgacgagttggctcaaaatggagacattaccgaggaa
aaggccgagtaccatcgccacttgaccattgtgggtctcgtgggctccattgataacgat
atggcaagcacagacgctactattggtgcctactcgtccttggaacgtatttctgagatg
gttgactacattgacgagactgcgctgtctcactctagagcgttcgtcgtcgaagttatg
ggccgtcattgtggctggttgggtttgatggctggtttgtccaccggtgccgactacatt
ttcatcccagagaaacctcctcgtcatggcgaatggcaagaggaacttaagaaggtgtgt
ctgcgtcatcgtggttacggtaaacgtaacaccacagtgattgtggctgagggtgccata
gacgatcagttgcagccaatcacttccgagcatgtgaagaatgtgcttgtggacatgaaa
cttgacacccgtatcactacattgggtcacgttcaaagaggaggtacagcggtggcatat
gaccgtttgttggcaaccttgcaaggtgtcgaggcagttcatgctgttttggagagtact
ccagaaacgccatcaccaatgattggtattctcgaaaacaaaattgtgcgccagcctttg
gtcgaatctgttcgtcttacaaagctggtagcagaagccatcgaaaacaaagactttgaa
aaggccatgagtctccgtgactcgagttttgccaacgcctacgaaacttacttgtcgaca
gcaatccatgacgatggaacacagctcttgccggagaacgagcgcttgaatattggtatt
gtgcatgtcggtgcctcgtcgtctgcgcttaatgccaccacacgtgcagcagcattgtac
tgtttgtccaagggccacaaattgttcgccatccaggacggtttctctggcttagctcac
agtggagttgttaaggaattgagctggatggatgtggatggctggcacaaccgcggtggt
tccgaaattggtactaaccgttcgttacctagcgaaagttttggcaatgttgcttactat
atgcagcggtaccagtttaatggtttgttgatcttgggtggctttgaggctttcacagct
ttgcatgagttggagtcccacaagcatgagtacccaattttcaacatccctaaggtggtg
atcccggccactgtgtctaacaatgttcctggaacggagtactccttgggttcggataca
tgcttgaaccaattggtcaactactgtgacgccattaagcaatccgcctcatccacgaga
agacgtgtctttgttgtcgaggtgcagggaggtaactcaggttatgtggcatgttacgct
ggtttggtcaccggtgctatggctgtttaccgtcctgaacaaaacatcaacttgaagagc
atccgcgaagacattgatttgttgacagctgttttcaagaacgatcgtggtgaggacaaa
aacggtaagatcgtcattcgtaacgaacatgcatcttctgtatactctaccgagttgttg
gcagacattttccgtgatgactctcatggtcgtttcgaaactagaactgctatccctggt
catgtgcaacaaggtttcactcctagctctatggaccggctgtacgctgtgcgttttgct
gtggaatcagtcaaatacattgaagagtggagtcgaaaggcattcaacactatccatcgc
gaccacacaagtcaccattccgtcaacaacatcaagatgattgaattgatgagaaaggag
gagaaggcatcggtggtaattggtattcaaggagcactgttaaagttttccgacgtaaac
gacttatacgagaaagatgcagacgtttctttgagaaagggtcgtacggtgcattggtca
agacttgcagaggtaggtgacattttaagtggccgtttgatgttgcgtgagggtaaggcg
tga

DBGET integrated database retrieval system