KEGG   Clavispora lusitaniae: CLUG_01865Help
Entry
CLUG_01865        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
clu  Clavispora lusitaniae
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:clu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 298 aa AA seqDB search
MFVPLLAFFQLALCVVARISGDVYSTDPNVYELTPANFDKVVYRSNYTSIVKFYAPWCGY
CQRLEPVWRKMARFLHQDGKYAVNVASVNCDSDRNKALCSKHRIQGFPTVIVFRPPKWKS
GATKNSASHVPEVYNGERALGPMIEFVSSRIKNYVKKFHRFDGDSLSEWLSDTSSPRVFL
MSSSPSITPLYKTMAIDFLGSASLGMITLKETPSEAHVDVDGVKVTFPLKPEDKLPLLFL
YKPEEHRFIRYKGKNLKNKQKIEQWLIDETGTAPGEGVLSKKDKKYYSKYRGHAKDEL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttcctcttctagcgttctttcaactagcgctttgtgttgtggcgcgtatctct
ggtgacgtttattctacggaccctaatgtttacgaacttacgccagcgaacttcgataag
gtggtttatcgttccaactacacttcgatcgtgaagttttatgcgccttggtgtggctac
tgccaaagacttgagcccgtgtggcgcaaaatggcacgttttctccatcaagacggaaaa
tacgctgtcaacgtggctagtgttaactgtgatagcgatcgcaataaggcgctttgttcc
aagcacagaatccagggatttcctactgtgattgtgttccgcccaccaaaatggaaatct
ggagcaacgaaaaactctgccagtcatgtgccagaggtctataacggtgaaagggcatta
ggaccgatgatagaatttgtatcatcgcggatcaagaactatgtcaagaaattccatcgt
tttgatggcgactccttgagcgaatggttgagtgataccctgagcccaagagtattcctc
atgtcgtcttcaccaagcattacacctctttacaaaaccatggccatcgactttttgggt
tcagcttctttgggtatgattacactaaaggaaactccctcagaggcacatgtggatgtc
gatggcgtgaaggtaacttttccattgaagcctgaggacaagttgccgctcttatttttg
tataaacccgaagaacaccgttttattcggtacaaaggtaaaaacttgaaaaacaaacaa
aaaattgaacagtggttgatagatgagactggaactgcgcccggagagggcgttttgtcg
aaaaaggacaaaaaatactactcgaagtatcgtggccatgcaaaggatgagttgtga

DBGET integrated database retrieval system