KEGG   Clavispora lusitaniae: CLUG_01883Help
Entry
CLUG_01883        CDS       T01149                                 

Definition
mitogen-activated protein kinase HOG1
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
clu  Clavispora lusitaniae
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:clu04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 375 aa AA seqDB search
MSTSGEFTRTQIFGTVFETTSRYTDLNPVGMGAFGLVCSAMDKLTGQNVAVKKIMKPFST
PVLAKRTYRELKLLKHLRHENLITLDDIFLSPLEDIYFVTELQGTDLHRLLTSRPLEKQF
IQYFTYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDTEVDMWSVGCILAEMIEGKPLFPGRDHVHQFSIITELLGSPPADV
IDTICSENTLRFVQSLPQREPIPFSERFASCTQVEPEAIDLLEKMLVFDPKKRISAVDAL
SHPYMEPYHDPTDEPSCETKFDWSFNDADLPVDTWRVMMYSEILSFHQMNSVPEEGQAPL
PVAASEAVPPAGASQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtccacatcaggcgagttcacccggacgcaaatcttcggtacggttttcgaaaccacg
ctgcgctatacggatttgaaccccgttggcatgggtgcctttgggctcgtgtgctcagcc
atggacaaactcacaggccaaaatgtggcggtcaagaaaatcatgaaacctttctcgacc
ccggtgttggccaagcgcacataccgtgaattaaagttgttgaaacacttgcgccacgag
aacttgattactttggatgatatcttcttgagccccttggaagacatttactttgtcaca
gagttgcaaggaacagacttgcatcggttgctcacatcccggccgttggaaaaacagttc
atccagtacttcacgtaccagattttgcgtggacttaagtatgtgcatctggctggcgtg
atccaccgtgacttgaagccgtccaacattctcatcaacgagaactgtgacctcaaaatc
tgtgactttggcttggcccgaatccaggacccccagatgacgggctatgtgtctactcgt
tactaccgtgcgccagagatcatgttgacgtggcaaaagtacgacactgaagtggatatg
tggtctgtggggtgtattttggcagaaatgatcgagggcaaaccacttttcccgggcagg
gaccacgtgcaccagttctcgatcatcacagagcttttgggctcgcccccagcagatgtc
atcgacacaatctgctcggaaaacactttacgtttcgtccagtctttacctcagcgtgaa
cctatcccattcagcgaacgttttgcttcgtgcacacaagtggagcccgaggccatcgat
ttgctcgagaaaatgctcgtgtttgacccaaaaaaacgtatcagcgcagttgatgccttg
tcacatccatacatggagccttaccatgaccccaccgacgagccgctgtgtgaaaccaag
tttgattggagcttcaacgacgcagacttgcctgtggacacttggcgagtcatgatgtac
agtgagattctttcgttccaccagatgaatagtgtccccgaagaaggacaggcgcctctc
cctgtagctgcctctgaagctgttccacccgcgggagcttctcaataa

DBGET integrated database retrieval system