KEGG   Clavispora lusitaniae: CLUG_01887Help
Entry
CLUG_01887        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
clu  Clavispora lusitaniae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:clu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 418 aa AA seqDB search
MTQLEDEVNGQFPPMILTPQTTVEFKLNEPIPTSTVMYSGPTRRIHFIDSRGVIRPIECE
SAKSVPDITNLTPTTFFLMTHTAQYLEQGETPISAILQGGYNHPLAREWQSERRLDKSMF
IFPLFVSDIDDEETAIPSLPNIKRYGVSKLADYVGPLVEKGLAAVILFGVILKDGVKDAQ
GTAADDPDGPVIRAVRLLREKFPSLYIMCDVCLCEYTSHGHCGILCDDGSINRAPSVSRI
AAVALAYARAGAHCVAPSDMMDGRIGAIKRGLIDEGLDNRVLVMSYSAKFSGNLYGPFRD
IAGSAPSHGDRRSYQLPAGGAGLARRALVRDIAEGADAFIVKPSTFYLDVVSEASRICRD
YPLCVYQVSGEYALLHAGAAQGVVDLKAIAFEAHNGYLRAGARLFISYFTPEFLEWLD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacttgaggatgaagtaaatggacagtttccaccaatgattctcacaccacaa
actacagtagagtttaaactaaacgaaccaattcctacgagtacagtaatgtactcgggt
cccacccgtagaattcattttatagattctagaggagtcatccgcccaatagagtgcgaa
agcgcgaaaagcgttccagacattactaatctcacaccaaccaccttctttctaatgaca
cacacggcgcaatacctcgaacaaggggagacgcctatctctgctatcttgcaaggtgga
tacaaccacccacttgcgcgcgagtggcagagcgaacgtcgtctcgacaagtcgatgttc
attttcccgcttttcgtctcagacattgatgacgaggaaacagccattccttcgttgcca
aatatcaagcggtacggcgtttcgaagttggcggactacgtggggcctcttgtggaaaag
ggattggctgctgtgattttgtttggtgtgattttgaaggacggcgtcaaggacgctcag
gggactgcggcagacgatccagacgggcctgtgatccgcgcggtgcgccttctccgcgaa
aagttccccagcctctacatcatgtgcgacgtttgcctttgcgagtacacctcgcacggc
cactgcggcattttgtgcgacgatggcagcatcaaccgcgcgcccagtgtatcgcgcata
gcggcggtagcgttggcttacgcccgtgcgggtgcgcactgtgtggcgccctcagacatg
atggacgggcggatcggcgccatcaagcgcgggcttatagacgagggcttggacaaccgc
gtgcttgtcatgagttacctggccaagttcagcggcaacttgtacggacctttccgcgac
attgctggcagtgcgccttcgcacggcgatagacgtctgtaccaattgcctgcgggcggt
gctgggttggcgcgccgggccttggttcgcgatattgccgagggcgccgacgcttttatt
gtcaagccatcgactttttacctcgatgttgtgagcgaagcgtcgcgcatttgccgcgac
tacccactttgtgtgtaccaggtgagtggcgagtatgccttgttgcatgcgggcgcggcc
caaggcgtggttgacttgaaggccattgcctttgaggcgcacaatggctacttgcgcgcg
ggcgcgcgcttgttcatcagttacttcacgcccgagttcttagagtggctcgactga

DBGET integrated database retrieval system