KEGG   Clavispora lusitaniae: CLUG_01887Help
Entry
CLUG_01887        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
clu  Clavispora lusitaniae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLUG_01887
Enzymes [BR:clu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CLUG_01887
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLUG_01887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 418 aa AA seqDB search
MTQLEDEVNGQFPPMILTPQTTVEFKLNEPIPTSTVMYSGPTRRIHFIDSRGVIRPIECE
SAKSVPDITNLTPTTFFLMTHTAQYLEQGETPISAILQGGYNHPLAREWQSERRLDKSMF
IFPLFVSDIDDEETAIPSLPNIKRYGVSKLADYVGPLVEKGLAAVILFGVILKDGVKDAQ
GTAADDPDGPVIRAVRLLREKFPSLYIMCDVCLCEYTSHGHCGILCDDGSINRAPSVSRI
AAVALAYARAGAHCVAPSDMMDGRIGAIKRGLIDEGLDNRVLVMSYSAKFSGNLYGPFRD
IAGSAPSHGDRRSYQLPAGGAGLARRALVRDIAEGADAFIVKPSTFYLDVVSEASRICRD
YPLCVYQVSGEYALLHAGAAQGVVDLKAIAFEAHNGYLRAGARLFISYFTPEFLEWLD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacttgaggatgaagtaaatggacagtttccaccaatgattctcacaccacaa
actacagtagagtttaaactaaacgaaccaattcctacgagtacagtaatgtactcgggt
cccacccgtagaattcattttatagattctagaggagtcatccgcccaatagagtgcgaa
agcgcgaaaagcgttccagacattactaatctcacaccaaccaccttctttctaatgaca
cacacggcgcaatacctcgaacaaggggagacgcctatctctgctatcttgcaaggtgga
tacaaccacccacttgcgcgcgagtggcagagcgaacgtcgtctcgacaagtcgatgttc
attttcccgcttttcgtctcagacattgatgacgaggaaacagccattccttcgttgcca
aatatcaagcggtacggcgtttcgaagttggcggactacgtggggcctcttgtggaaaag
ggattggctgctgtgattttgtttggtgtgattttgaaggacggcgtcaaggacgctcag
gggactgcggcagacgatccagacgggcctgtgatccgcgcggtgcgccttctccgcgaa
aagttccccagcctctacatcatgtgcgacgtttgcctttgcgagtacacctcgcacggc
cactgcggcattttgtgcgacgatggcagcatcaaccgcgcgcccagtgtatcgcgcata
gcggcggtagcgttggcttacgcccgtgcgggtgcgcactgtgtggcgccctcagacatg
atggacgggcggatcggcgccatcaagcgcgggcttatagacgagggcttggacaaccgc
gtgcttgtcatgagttacctggccaagttcagcggcaacttgtacggacctttccgcgac
attgctggcagtgcgccttcgcacggcgatagacgtctgtaccaattgcctgcgggcggt
gctgggttggcgcgccgggccttggttcgcgatattgccgagggcgccgacgcttttatt
gtcaagccatcgactttttacctcgatgttgtgagcgaagcgtcgcgcatttgccgcgac
tacccactttgtgtgtaccaggtgagtggcgagtatgccttgttgcatgcgggcgcggcc
caaggcgtggttgacttgaaggccattgcctttgaggcgcacaatggctacttgcgcgcg
ggcgcgcgcttgttcatcagttacttcacgcccgagttcttagagtggctcgactga

DBGET integrated database retrieval system