KEGG   Clavispora lusitaniae: CLUG_01895Help
Entry
CLUG_01895        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
clu  Clavispora lusitaniae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CLUG_01895
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CLUG_01895
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLUG_01895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 628 aa AA seqDB search
MPRRSSTAPSAPVVATIDIGTTSARCILFSKDGTEVAKHQIEYSTSASEAPAESSNTDQF
RRRSSLARHNEPIFTAEGVAISISDHVEIENNAASVGPTLRFPQPGWVECMPVHILANAV
QCLVACLITLRKINQNPDLKIKYKVKCIGIANMRETTIVWDRKTGKPLSNGITWTDTRTA
EIVHHLENMTDDETKARMKEKTGLPLSTYFSAAKLRWLLDNDDTIRELYEKGDNLMFGTV
DTWLIYHLTKERTFVTDVTNASRTSFMNLETRDYDDELLDFWGIDPSKISMPKIVSSSEF
YGSFVAPNLSSLGFHNRITQEAYDMLKTIYNVPICGCLGDQSASLVGQLAVKAGSAKCTY
GTGCFLLYNTGVRRLTSNNGALTTLGFWFPTLGGEDGQPHYALEGSVAVAGSIIQWLRDN
LKLIESAKDIGPLASQASNSGGVVFIPAFSGLYAPYWDGGARGTIFGMTQYTSSAHIARA
ALEGVCFQVRGILRAMSEDAGGSKDFLEEALHSQHEDKPLSTLAVDGGMSKAGEVLQIQA
DILGPCVTVKRAAISECTALGAAIAAGVSFKDENERVWRDFEDVIQSVTGEDDEANVFKA
KLPDVDRRKNWRRWERAVERAKGWLDEE
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccgctcttctaccgcgccatcggcacctgtggtggcgaccattgacattggt
acaacctccgcccgctgcattcttttcagcaaagatggtaccgaagtggccaagcaccag
atcgagtacctgacttcagcgtccgaagccccggcagaatcgctgaacacagaccagttt
cggcggcgtagttcgcttgcgcgccacaacgaacccattttcaccgctgagggtgttgcc
attctgatttcggaccatgtggaaatcgagaacaatgcggcctctgtgggtcctactttg
cgtttccctcagccaggttgggtcgaatgtatgcctgtgcacattttggccaacgctgtg
cagtgtcttgtggcttgtcttatcacgttgcgcaaaatcaaccagaaccctgacctcaag
atcaagtacaaggtcaagtgtatcggtattgccaatatgagagaaacaacaattgtgtgg
gaccgcaagacaggaaagcccttgagcaacggtatcacatggacagacacacgtacagcg
gaaatcgtgcaccacttggaaaacatgacggatgacgagacaaaagcacgtatgaaagaa
aagacaggcttacctctttctacgtatttcagtgcagccaagttgcgctggttgttggac
aatgatgataccattcgcgaactatacgaaaagggtgacaatttgatgttcggtaccgtg
gacacatggcttatctaccacttaaccaaagaacgtacttttgtcaccgatgttaccaat
gcatcacgtaccctgtttatgaacttggagactcgcgattacgatgatgagttactagac
ttttggggaatcgacccatcgaagatttccatgcctaaaatcgtatcgagcctggagttc
tatggcctgtttgtggcgcccaacttgtctagcttgggattccataacagaatcacccaa
gaagcctatgacatgcttaaaacaatttacaatgtgcctatctgtggctgtttaggagac
cagtctgcttcattggttggtcaattggcagtgaaggctggttctgcaaagtgtacttac
ggaacaggttgtttccttttgtacaatacgggtgtgcgtcgtttaacatccaataacggt
gccctcacaaccttaggtttttggttcccaactttgggtggcgaggacggccagcctcat
tatgccctagaaggttctgtcgctgtggctggatcgatcatccaatggttgcgtgataac
ttaaagcttattgaaagtgccaaagacattggacctttggcttctcaagcaagtaactcg
ggtggtgttgtgtttattccagccttttccggactttatgcgccatactgggatggtggc
gctcgtggaaccattttcggaatgacccagtatacatcatcggcacatattgctcgcgct
gcgcttgaaggtgtttgtttccaggttcgtggcattctcagagcaatgtctgaagatgct
ggcgggtcgaaagatttcttggaagaagctttgcacagtcaacatgaagataagccatta
tctacgttggctgtcgatggcggaatgtcgaaagctggagaggttttgcaaatccaagca
gacattttgggtccgtgtgtcacagttaaaagagcggccatttcggaatgtaccgcattg
ggcgctgctatcgcagctggcgtttccttcaaagatgagaatgaacgtgtttggagggat
ttcgaagatgtgatccagctggtgacaggtgaggatgacgaggccaatgttttcaaggca
aaacttcctgatgtcgacagaagaaaaaactggagacgctgggagcgggctgttgagagg
gcaaagggctggctagatgaggagtga

DBGET integrated database retrieval system