KEGG   Clavispora lusitaniae: CLUG_02018Help
Entry
CLUG_02018        CDS       T01149                                 

Definition
similar to AGR201Cp
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CLUG_02018
Transfer RNA biogenesis [BR:clu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CLUG_02018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 542 aa AA seqDB search
MPSLPPEKERFLQCCSDIASELVASLKSNKDTNLNGVVSRHSKKLKLKHQPRLTDIIAAI
PDQHKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYST
QSYTGYEPTSMRAIRARYDPYEQARGRIDQLRSLGHSIDKVEYIVMGGTFMSLPVEYREH
FIAQLHNALSGYSGTDLTESIRFSQQAQTKCVGITIETRPDYCTETHLSDMLTYGCTRLE
VGVQSVYEDVARDTNRGHTVKAVCETFAVAKDAGYKVVSHMMPDLPNVGMERDLQQFVEY
FENPEFRTDGLKIYPTLVIRGTGLYELWKRGLYKSYSANALVDLVARIMALVPPWTRIYR
VQRDIPMPLVTSGVENGNLRELALARMKDFGTSCRDVRTREVGIQEVHHKVAPDQVELIR
RDYYANGGWETFLSYEDPKQDILIGLLRLRKAAKPFRRELKGQRTSLVRELHVYGSVVPL
HSRDPRKFQHQGFGTLLMEEAARIAKEEHGSTKISVISGVGVRNYYARLGYELDGPYMSK
ML
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgccctctctcccacctgaaaaagaacggtttctccagtgctgcagcgacatcgccagc
gagcttgtggcgctgctcaagtccaacaaggacacaaacctcaacggcgtggtgtcccgc
cactcgaaaaagctcaagctcaaacaccagccgcgcttgaccgacatcatcgccgccatt
ccagaccagcacaagaagtacttgcttcccaaactcaaggccaagcctgtgagaacagcg
tccggtattgctgtcgtcgccgtcatgtgcaagccgcaccgctgtccccacattgcatac
acgggaaacatctgtgtctactgccctggcggaccagactcggactttgaatactccacg
cagtcatacacgggctacgagcccacgctgatgcgggccatccgcgcccgctacgacccg
tacgagcaggcccgcgggcggatcgaccagctccggctgttgggccatctgatcgacaaa
gtcgagtacattgtcatgggcggcaccttcatgtcgttgcccgtggagtaccgcgagcac
ttcattgcccagttgcacaacgccttgtccggatactcgggcaccgaccttactgagtcc
atccgtttttcccagcaggcgcagaccaaatgtgtcggcatcaccatcgagaccagaccc
gactactgcacggaaacacacttgagcgacatgttgacgtatggctgcacccgtttggag
gtcggtgttcagctggtctacgaagacgtggccagagacaccaacagaggtcacacggtg
aaggccgtttgcgaaaccttcgccgtggccaaggacgcgggctacaaagtggtcagccac
atgatgccggacttgcccaacgtggggatggagcgggacttgcagcagtttgtcgagtac
tttgaaaacccagagttccgtaccgacggcttgaagatctacccaaccttagtcatccgt
ggcacaggcttgtacgagttgtggaagcgcggtttgtacaagtcgtacagcgccaatgcc
ttggtggacttggttgcccggatcatggctcttgtgccgccctggaccagaatctacaga
gtgcagcgtgacattcctatgcccttggtcacttctggtgtggaaaacggaaacttgcgt
gagttggcgcttgccagaatgaaagactttggtacatcctgccgagatgtgagaacaaga
gaagtgggtatccaggaagtccaccacaaggtggcgccggaccaggtcgagcttattcgc
cgtgactactatgccaacggcggctgggagacattcttgctgtacgaggatccgaagcag
gacattttgatcggtcttctccgtttgcggaaagccgccaagccattccgccgggaattg
aagggccagcgcacttctcttgtccgtgaacttcacgtttacggatctgtggtgccgttg
cattctcgagacccacggaagttccagcaccagggtttcggaacgttgttgatggaagaa
gctgcacgcattgcgaaagaggaacacggctccaccaagatttctgtcatctctggtgtg
ggtgtgcgtaattactacgcaagattgggatacgagttggacgggccatacatgtccaag
atgctctga

DBGET integrated database retrieval system