KEGG   Clavispora lusitaniae: CLUG_02093Help
Entry
CLUG_02093        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CLUG_02093
Peptidases [BR:clu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CLUG_02093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 476 aa AA seqDB search
MAFTISIKNAGKVHEIELEDSATGLEFKKKIQDITQIPVERQKILIKGGKLSDDVVVSTL
KANLKNPIMVLGTPDKDLPVFDSNKHVFLEDLNENQLVKVAEEPSGLINLGNTCYLNSSL
QALYNIKDISDKVKSSSGSTAMITTLKGIFNAMGKKQQNVDPTLFLMQFRAQFPQFAEQE
MGMYKQQDAEEAFSQIMTVLGSTFDINDAFRIDFKTVTKCLSLPEEEPKIGSDSASKLSC
HIDIKTNFLRDGIINGLTDKLEKRNETLNANAEYEITKTITRLPKYLTVHFMRFFWRRDT
RKKSKILRKVQFPFELDLSEMLDPSIKQEKIEVRDKLRKIEKDNDELIRDFKKAKKDKSL
TPKQQQEEDELKIESIKSKFMDDFAGILPKDFSFETATENPSSVYELQAIITHQGSSADS
GHYQAFVKNEKDLEGESWWKFNDNKVSSVNRDKIEALAGGGESDSALILIYKAKGF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcttttacaatttccataaagaacgctggaaaagtccatgaaatcgaattggaagat
tctgctactgggttggagtttaagaaaaagatccaggacataacccagattccggtggaa
cgccagaagattttgatcaagggaggcaaattgagcgatgatgtggttgtttcaacactc
aaagctaacttgaaaaatccaattatggtcctcggaacaccagacaaggacttacctgtg
tttgactcgaacaaacacgtgtttttggaagatttgaacgaaaaccaattggtcaaggtt
gcggaagaaccttctggattgatcaacttgggcaacacctgctacttgaactcttcattg
caagcgctctacaacatcaaggatatttctgacaaagtgaaaagctcctcaggatcaact
gctatgatcactactttgaagggtattttcaacgcaatgggaaagaaacaacagaatgtg
gaccctacacttttcctcatgcagttcagagcccaattcccccagtttgcagagcaagaa
atgggtatgtacaaacaacaggatgcagaggaggcgttctcccaaatcatgaccgttttg
ggttctactttcgacattaatgacgcgtttagaattgactttaagactgtcaccaaatgt
ttgagcttgccggaagaagaaccgaagattggttcagactcggcttccaaattgagttgt
cacattgacatcaagactaatttcttgagagacggaatcatcaatggattaacggataaa
cttgaaaagagaaacgaaacattaaacgcgaatgctgagtacgagataaccaaaaccatc
actaggttgccaaagtacttgactgtgcactttatgagattcttttggagaagagacaca
cgtaagaaatccaagattttgagaaaagtgcaatttcctttcgaactagacttatcggaa
atgcttgacccatcaatcaagcaggaaaaaattgaagtgagagataaattgagaaaaatc
gaaaaggataacgatgaattgattagagatttcaagaaggccaagaaggacaagtcctta
accccaaagcaacaacaagaagaagatgaattgaagatcgaatctataaagtccaaattc
atggatgactttgcagggattttgccaaaagatttcagcttcgaaactgccacagaaaac
ccatcttccgtgtacgagttacaggcaatcatcacccaccagggctcgtcggccgactcc
ggtcattaccaggcatttgttaaaaacgagaaggatctcgagggtgagagctggtggaaa
tttaatgacaacaaggtttcgtctgttaacagagacaagattgaagctttggctggtggc
ggagaaagcgactcagcattgattctcatttataaagccaagggattctag

DBGET integrated database retrieval system