KEGG   Clavispora lusitaniae: CLUG_02148Help
Entry
CLUG_02148        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
clu  Clavispora lusitaniae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:clu03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:clu03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
METPKPKKYVSADDLYRRSTQYQVWSFTASELERKKAAANEKGRAAAVGRFEDAFKALEA
EKPALVASHGAQLRSCIELISLEEEQKYLSFFCGQIVQICTHFQMPTQVKATAISFFKKF
YLVNSAMEYRPRNVLYTIVFLAAKSENHFVSIESFCSKIPNTKPQDILELEFAVLQSLRF
TLLVHHPFRPLYGFFLDFQHVLLHPEPVFPSLSVDTIGNLYDTAKKWLNDHALLSDASFL
FTPPQIALAALYAVDPKLTEKYLRRKFAKERKQEKAAKLEPVKEENESANGKDEPSKENG
ASENGNKEKDSYELLLSTIKECIQVAQTETKTSREESTLIDKKCFFALNPAKLLKKKIKS
LEEK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgccaaaacccaaaaaatacgtctctgccgacgatctctaccgccgatcgacg
cagtaccaggtctggtcgtttactgccagcgagcttgagcgcaaaaaggcggcggccaac
gaaaaaggccgagcggcggccgttgggcggttcgaagacgccttcaaggcgctagaagca
gaaaaaccggcgcttgtggcctcgcatggcgcccagttacgcagctgtatcgagctcatc
tcgcttgaagaggagcagaagtatctctccttcttctgcggccagattgtccagatctgc
acgcatttccaaatgcccactcaagtgaaggccaccgccatctctttcttcaagaagttc
tacttggtcaactcggccatggagtaccggccccgcaatgtcttgtacaccattgtgttt
cttgcggcgaagctggaaaaccactttgtgtccatcgagtccttctgctccaagatcccc
aacacaaagccccaggacatcttggagttggagtttgcggtgctccagtcgctccgcttc
acgcttctcgtccaccacccgttccgcccgttgtacggctttttcttggacttccagcac
gtgcttttgcatccggaacccgtgttcccatctctttctgtcgacacgatcggcaacctc
tacgacacggcgaaaaaatggctcaacgaccatgcgttgctcagcgacgcctcttttctc
ttcacgccgccccagattgcccttgcggcgctctatgccgtggacccgaaactcacagag
aagtatcttcggcgcaagtttgccaaggaaagaaagcaggagaaggcagcgaaactagaa
ccagtgaaagaggagaatgagtcggccaatggcaaagacgagccatccaaagagaatgga
gcttctgaaaatggcaataaggaaaaagacagctacgaacttttgctctctacaatcaag
gaatgcatccaggtggcccagacggaaacgaaaacgtctcgggaggaaagcacgcttata
gacaaaaagtgttttttcgctttgaacccggccaagctcttgaagaagaaaatcaagtcg
ctcgaagagaaatag

DBGET integrated database retrieval system