KEGG   Clavispora lusitaniae: CLUG_02266Help
Entry
CLUG_02266        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
clu  Clavispora lusitaniae
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLUG_02266
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CLUG_02266
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CLUG_02266
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CLUG_02266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 418 aa AA seqDB search
MSHKSYTIVIKLGTSSLVDEVTREPRIANMANIVETVVKLRRAGHRIVVVSSGAIAFGMR
RVGVTEKPKQLAAVQALASIGQGRLIGLFDDMFRQMNQAVAQILITRNDIIDFTQYKNAV
NTIQQLLAMDVIPIVNENDTLSVAEIKFGDNDTLSAITAGMIHADYLFLMTDVPCLYTDN
PRTNPDAKPVLFVDKIDELAVKTDTEAGSKVGTGGMTTKLIAAELATNVGATTIVTLSSQ
PQYILDIVASIQNAPDGTSQEQEQHVAKEISAGRLPLHTRFVALPKNEQIKSDRRFWLLH
GLRTKGSLYIDSGCYEALTRKDRAGLLPAGVVAVTGQFHESECVSIKVIPKRLGTGSESL
ETVLQSAVEVGHCRVNYSSTEIDLIKGLRSSEIEKVLGYADSEYVAHRDNLAFPPESR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacaagtcctacaccattgtgatcaagcttggaacatcgtcgttggtcgacgaa
gtgacacgcgagcctcggatcgccaacatggccaacatcgttgaaacggtggtgaaactc
cgccgcgcgggccatcgcattgtggttgtctcctctggagccattgcgtttggtatgaga
agagtaggtgtcacagaaaagcccaagcaattggccgcagtacaggcattggcgtctatc
ggtcaaggccggttgatagggctctttgacgacatgttccggcaaatgaaccaggcggtg
gcgcagattctcatcaccagaaacgacattatcgatttcacccagtacaagaacgccgtc
aacaccatccaacaattgttggccatggatgtgatccccattgtcaacgaaaacgacacc
ttgtccgtggccgagatcaaattcggtgacaatgacacgctttcggccatcacagcaggt
atgatccatgcagactatctctttctaatgaccgacgtgccatgtttgtacacggacaac
ccacgcacgaacccagacgccaagcctgtacttttcgtcgacaagatcgatgagcttgca
gtgaaaacagacacagaagccggcagcaaagttggaacgggcggaatgaccacgaaattg
attgctgcggagttggctacgaatgtcggtgctaccaccattgttacgctctcgtctcaa
ccacagtacattttggacatcgtggccagcatccagaatgcgccagatggaactctgcaa
gaacaagagcaacatgtggccaaggagatttctgctggtcgtcttccgctccacacgcga
ttcgtggcacttcctaaaaacgaacagatcaagtccgaccgccggttttggcttttgcac
ggcctccgtactaaaggttcgttgtacattgacctgggctgctacgaagctttgacccgc
aaagacagagcggggcttttacctgctggagttgtggcagtgacgggccagttccatgag
agcgaatgtgtgtcgatcaaggtgatccctaagcggttgggcacagggctggagtcgtta
gagactgtgttgcaaagtgcagtcgaggtgggccattgtcgtgtcaactacagctccacg
gaaattgatttgatcaagggccttcggagcagcgagattgaaaaggttttaggatacgcc
gactctgagtatgtggcccatagagacaatctcgcattcccaccagagagcagataa

DBGET integrated database retrieval system