KEGG   Clavispora lusitaniae: CLUG_02306Help
Entry
CLUG_02306        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
clu  Clavispora lusitaniae
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    CLUG_02306
  Amino acid metabolism
   00380 Tryptophan metabolism
    CLUG_02306
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     CLUG_02306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 491 aa AA seqDB search
MLIDIIISNISVSFWCLCFFFLSWKIFRIIYPPFDFPKNIPTIPFYAAFVSSFLGWDQNK
VYAHYYRENLEKYGAAKIYFASRWNILVTKPEYLAQIFKQNEIFEKSGNQHKIPYSLLAE
YTGDNIISTGNKYWKLYRKAVTNSIQFPNLEPLQTNATVLIENLSAASDNGYFPIADILQ
AYTLNNVGDCVIGTNFHKSDNFDISTSLKKVKQEIFRPLFLNFPLLDLLPFPSRIRARKL
VRSFKRNYCNKILNELNEENKGRLGHNLATFWKQGDITEKQFQDNAMIAMIAGHENPQLL
LTSLIYVIAKYPEIQRQLRSEMNSSNYDVKEQIPLLKAVVYETIRLFPPLGLIVNRKTRK
NVILGNGIFIPKGTYVGYNNFGTQRDRNYWGDDADAFRPERWGNDGKKIEEKYAEAKSKC
TLPAFHGRSRACLGEKFALAEVRKAVIEILQNFEISLDPSWKEQLTPAGPICPLKLSVML
KKVCSEHEHNI
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgttgattgatataattatttccaatataagtgtcagtttttggtgcttatgcttcttt
ttcctatcatggaaaatcttccgaattatttatccaccgtttgacttccctaaaaatata
cccactattccattttacgcagcttttgtgagttcatttctaggatgggaccaaaataaa
gtatacgcccattactatcgtgaaaatttagagaagtatggtgctgctaagatttatttt
gcgtctagatggaatatcttagtgaccaaacctgaataccttgctcaaatctttaaacaa
aatgaaattttcgaaaagagtggtaatcagcacaaaattccatattctttactagcagaa
tacactggtgacaatattattagcactggaaataagtactggaaactctatcgcaaagca
gtgaccaatagcatccaattcccaaatttggaacccttgcaaaccaatgctacagtgttg
attgaaaatttatctgcagcttcagataacggatactttcctattgcagatatacttcaa
gcatacacgttgaataatgtaggggattgtgtcataggaacaaacttccataaatctgac
aattttgacatttctaccagcctcaaaaaggtcaaacaggagatttttcgtcccttattc
ctcaactttcccttattggacttacttccctttccaagcagaatccgggcaagaaaattg
gtacgttctttcaagagaaattattgcaacaagattttgaatgagctaaatgaggagaat
aaaggaaggttgggacacaaccttgcaacattttggaaacaaggcgatatcactgaaaaa
cagttccaagataatgccatgatagccatgatcgctggtcatgaaaacccccagttgctt
ttaacatctctcatatacgtcatcgcaaagtatcctgaaatccaacgacaattaagaagt
gagatgaattcctccaattatgatgttaaagagcaaattccattattgaaagcagttgta
tatgagactattaggctcttcccacctttgggactaatagttaacaggaaaacgagaaaa
aatgtgattttgggtaacggtatatttattccgaaaggtacttatgttggatacaacaat
ttcgggacacaaagagacaggaactactggggggatgatgccgacgcctttcgtccagaa
cgttggggaaatgacggaaaaaaaatagaagaaaagtacgctgaggctaagagcaagtgc
acattacctgccttccacggaagaagtagggcttgcctaggtgagaaatttgctttagca
gaagtaaggaaggccgtgattgagatattgcaaaacttcgagattagtcttgacccctcc
tggaaagagcaactcactccggcagggccaatttgtcctttgaagttatctgtcatgcta
aaaaaggtatgctctgaacacgagcataacatataa

DBGET integrated database retrieval system