KEGG   Clavispora lusitaniae: CLUG_02460Help
Entry
CLUG_02460        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
clu  Clavispora lusitaniae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CLUG_02460
  Replication and repair
   03420 Nucleotide excision repair
    CLUG_02460
Transcription machinery [BR:clu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CLUG_02460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 511 aa AA seqDB search
MSANSFKLTVNEHLEGLPKVIQSKLYDAPATCLSIFRLLPPLAKFYIVSMVFTDKPVAVK
DLEKWCQPQARKLQYESFKRLRALHLIEEDQSGTHVRLHQTFRNNFRDCLTGSQAPNAFG
IIVPGSDKHPIDVKFLDQFASQKWETILHFMVGTELPTVPSKSVLSLLKSGGLMEGHGTS
AYSLKITNSGFQFLLQDVNVQIWTLLLEYLNLTQELNMDPVDVLNFIFILGSLELGKAYA
VSSLSDTQLSMLPDLRDYGLVYQRSENSTRFFPTRLATTLTSESTGLKTPSMALNQTLED
PGAKDQEHVTSEAGESQSGQIILETNFKLYAYTNSPLEIAILNLFVNLKVRFANMVIGQI
TRESIRKALYNGITADQIIKFLETHAHSQMRTSAKEKLDKKIEFDASHNINTAGGAPQSK
SSDSGVAQHRLEILPPNVVDQIKLWQLELDRIQTFEGYLFKDFKNQNEYDVLCNYATEVG
VLLWSDKTKLRFFVTAEGMHQVADFASRKFR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctaatctgtttaaactcaccgtcaatgagcatttggaagggcttcctaaggtg
attcaatctaaattatatgatgcaccagcaacatgtttgtcgatttttcgtttacttccc
cctctcgctaaattttacattgtgagtatggttttcacagacaagcctgttgccgttaaa
gatctagaaaaatggtgccaacctcaagctcgcaaacttcagtatgagtctttcaagcgt
ctccgcgctttgcatttgatagaggaagaccagagcggaactcatgttcgcctacatcaa
actttcagaaacaacttcagagactgtttgacaggttcacaggcccccaatgcattcggt
ataattgtacctggctcggacaagcatccaatagatgtgaagttcctcgatcaatttgca
tcgcagaagtgggaaacaattttgcattttatggtgggaacggaactcccgactgtgcct
tccaagtctgtactctcgcttttgaaactggggggcctcatggaagggcatggtacgagc
gcgtatagtctcaagattacgaacagtggctttcagttcttgttgcaggatgtcaacgta
cagatatggactctattgttggagtaccttaatttgacgcaagaattaaatatggatccc
gtcgatgtcttgaatttcattttcatcctaggatcgctagagttaggcaaagcatatgcg
gtctctagtttaagtgatactcaacttagtatgttgccagatctaagagactatgggctc
gtctatcaacgatcggaaaattctacgagattcttcccaacgagattggccactacgtta
acttcagagtccacgggattgaaaactccgtcgatggctttaaatcaaaccttggaagac
cctggagcgaaggaccaggaacatgtcacctcagaggctggtgaatctcagctgggtcag
attattttggaaacgaacttcaagctttatgcatatacaaactcacctctagagattgct
atattaaatttgtttgtgaatttgaaagtacgtttcgccaatatggttattggtcaaatt
acaagagagtctatcaggaaagcactttataatggaatcactgcagaccagataatcaag
tttctcgagactcatgcccattcccagatgagaacttctgcaaaggagaaattggataag
aaaattgaatttgatgccagccataatataaacacagccggtggagcaccacaatccaag
tcttctgactccggtgtcgctcagcatcgtttggaaatccttcccccaaatgtggtagat
caaataaaactttggcagttggagttagaccgaattcagacatttgaggggtatcttttt
aaggacttcaaaaatcagaatgagtatgatgttttatgcaattatgctacagaagttggt
gtgcttctttggtcagataagacaaaattgcgctttttcgttacagcagaaggaatgcac
caggtggccgacttcgctagtcgtaaatttcggtga

DBGET integrated database retrieval system