KEGG   Clavispora lusitaniae ATCC 42720: CLUG_02460Help
Entry
CLUG_02460        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu03022  Basal transcription factors
clu03420  Nucleotide excision repair
Module
clu_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CLUG_02460
  Replication and repair
   03420 Nucleotide excision repair
    CLUG_02460
Transcription machinery [BR:clu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CLUG_02460
DNA repair and recombination proteins [BR:clu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CLUG_02460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 8498071
NCBI-ProteinID: XP_002617016
UniProt: C4Y488
AA seq 511 aa AA seqDB search
MSANSFKLTVNEHLEGLPKVIQSKLYDAPATCLSIFRLLPPLAKFYIVSMVFTDKPVAVK
DLEKWCQPQARKLQYESFKRLRALHLIEEDQSGTHVRLHQTFRNNFRDCLTGSQAPNAFG
IIVPGSDKHPIDVKFLDQFASQKWETILHFMVGTELPTVPSKSVLSLLKSGGLMEGHGTS
AYSLKITNSGFQFLLQDVNVQIWTLLLEYLNLTQELNMDPVDVLNFIFILGSLELGKAYA
VSSLSDTQLSMLPDLRDYGLVYQRSENSTRFFPTRLATTLTSESTGLKTPSMALNQTLED
PGAKDQEHVTSEAGESQSGQIILETNFKLYAYTNSPLEIAILNLFVNLKVRFANMVIGQI
TRESIRKALYNGITADQIIKFLETHAHSQMRTSAKEKLDKKIEFDASHNINTAGGAPQSK
SSDSGVAQHRLEILPPNVVDQIKLWQLELDRIQTFEGYLFKDFKNQNEYDVLCNYATEVG
VLLWSDKTKLRFFVTAEGMHQVADFASRKFR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctaatctgtttaaactcaccgtcaatgagcatttggaagggcttcctaaggtg
attcaatctaaattatatgatgcaccagcaacatgtttgtcgatttttcgtttacttccc
cctctcgctaaattttacattgtgagtatggttttcacagacaagcctgttgccgttaaa
gatctagaaaaatggtgccaacctcaagctcgcaaacttcagtatgagtctttcaagcgt
ctccgcgctttgcatttgatagaggaagaccagagcggaactcatgttcgcctacatcaa
actttcagaaacaacttcagagactgtttgacaggttcacaggcccccaatgcattcggt
ataattgtacctggctcggacaagcatccaatagatgtgaagttcctcgatcaatttgca
tcgcagaagtgggaaacaattttgcattttatggtgggaacggaactcccgactgtgcct
tccaagtctgtactctcgcttttgaaactggggggcctcatggaagggcatggtacgagc
gcgtatagtctcaagattacgaacagtggctttcagttcttgttgcaggatgtcaacgta
cagatatggactctattgttggagtaccttaatttgacgcaagaattaaatatggatccc
gtcgatgtcttgaatttcattttcatcctaggatcgctagagttaggcaaagcatatgcg
gtctctagtttaagtgatactcaacttagtatgttgccagatctaagagactatgggctc
gtctatcaacgatcggaaaattctacgagattcttcccaacgagattggccactacgtta
acttcagagtccacgggattgaaaactccgtcgatggctttaaatcaaaccttggaagac
cctggagcgaaggaccaggaacatgtcacctcagaggctggtgaatctcagctgggtcag
attattttggaaacgaacttcaagctttatgcatatacaaactcacctctagagattgct
atattaaatttgtttgtgaatttgaaagtacgtttcgccaatatggttattggtcaaatt
acaagagagtctatcaggaaagcactttataatggaatcactgcagaccagataatcaag
tttctcgagactcatgcccattcccagatgagaacttctgcaaaggagaaattggataag
aaaattgaatttgatgccagccataatataaacacagccggtggagcaccacaatccaag
tcttctgactccggtgtcgctcagcatcgtttggaaatccttcccccaaatgtggtagat
caaataaaactttggcagttggagttagaccgaattcagacatttgaggggtatcttttt
aaggacttcaaaaatcagaatgagtatgatgttttatgcaattatgctacagaagttggt
gtgcttctttggtcagataagacaaaattgcgctttttcgttacagcagaaggaatgcac
caggtggccgacttcgctagtcgtaaatttcggtga

DBGET integrated database retrieval system