KEGG   Clavispora lusitaniae: CLUG_02479Help
Entry
CLUG_02479        CDS       T01149                                 

Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
clu  Clavispora lusitaniae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 497 aa AA seqDB search
MVDRKRGATSSANENSKRKKGGRSKDVKLEDEEEFQEDGLMESSPSPPLESDTDTAVKDE
DIEEEEDGKSDDEAFEKSSNANSDALKEDDDDEDNEDEKDDTENKADGEEDEEKVNESDN
DDEDEEEKRRITTFNFDGTEYTFKERPSVIEERDGKIEFRVVNNDNTRENLIVLTGLMNI
FQKQLPKMPREYISRLVYDRSHLSMAVVRKPLTVVGGITYRPFDSRGFAEIVFCAISSTE
QVRGYGAHLMNHLKDYVRATSPIKYFLTYADNYAIGYFKKQGFTKEITLPKNIWMGYIKD
YEGGTLMQCSMLPSRMRYLDSGKILLLQKAAIEKKIKMRSKSHVVRPGLQVFKNAAPGFK
LSAKDIPGLLESGWSEEMDKLAQKPKRGPHYNFMVTLLSELTNHPSAWPFAVPVNKEEVG
DYYDVIKEPMDLSTMEQKLENDKYETFDQFLYDCKLIFNNCRSYNAESTTYFKNATKLEK
FLNKKIKESADYSHFLE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggttgaccgtaaaagaggggccaccagttcagcgaacgagaattcgaagcgtaagaaa
gggggccggtctaaagatgtgaagctcgaggatgaagaagagttccaagaagatggattg
atggagagttcgccaagccctccactagagtctgacacagatactgcggtgaaagatgag
gacatagaagaggaagaagatggtaagtcggacgacgaagcgtttgaaaagagctctaat
gcgaatagtgatgcgctcaaagaagatgacgatgatgaggataacgaggatgagaaagat
gatacagaaaataaagctgatggtgaagaagatgaagaaaaggtgaacgaaagtgacaat
gatgacgaagacgaagaagaaaaaagacgtataaccacattcaatttcgatggaactgag
tacacgtttaaagagaggccctcagtcattgaagaaagagacgggaaaattgaattccga
gtggtcaataacgacaatacaagggaaaacctcattgttctcactggtcttatgaacatt
tttcagaaacagttgcccaagatgcccagggaatacattctgagattagtatacgatcgc
tctcatttgtctatggcggtggttagaaaacctttgacagtggtaggtggtattacgtat
cgtccttttgacagcagaggctttgctgaaattgtgttttgtgccatatcgtctacagag
caagtgagaggttatggtgctcatttgatgaatcatttgaaagactatgttagagcgacg
tctccaatcaaatactttttaacatatgccgataactatgccattggctacttcaaaaaa
caaggctttaccaaagaaatcactcttcctaagaatatatggatgggatatataaaagat
tacgaaggtggtacattgatgcaatgctcgatgcttccttcacgcatgcgctatcttgat
tcgggaaagattttactattacagaaagcggcaatcgagaaaaagataaaaatgagatcc
aaatcacatgtggtgcggccgggtcttcaggttttcaaaaatgctgcgccgggtttcaag
cttctggcgaaggatatcccaggccttttggagagtggttggctggaagaaatggacaag
cttgcacagaaacctaaacgcggaccgcactacaacttcatggttacgctattatccgag
cttactaatcatcctctggcttggccatttgcggttcctgtcaataaagaagaagtgggt
gactattacgacgtcattaaggaaccaatggacttgtcgactatggagcagaaactcgag
aacgacaagtacgaaacatttgatcagtttttgtacgattgcaaattgatcttcaacaat
tgccggtcttacaatgccgaaagcactacctatttcaaaaatgccactaagcttgaaaag
ttcttaaacaagaagatcaaagaaagcgccgattattcgcactttttagaataa

DBGET integrated database retrieval system