KEGG   Clavispora lusitaniae ATCC 42720: CLUG_02601Help
Entry
CLUG_02601        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00062  Fatty acid elongation
clu01100  Metabolic pathways
clu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    CLUG_02601
Enzymes [BR:clu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     CLUG_02601
Lipid biosynthesis proteins [BR:clu01004]
 Fatty acid synthase
  Component type
   CLUG_02601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF676 Caudal_act
Motif
Other DBs
NCBI-GeneID: 8497586
NCBI-ProteinID: XP_002617157
UniProt: C4Y4M9
AA seq 317 aa AA seqDB search
MQIFRQLTLALSGLSINSKWTPVSHSVHKEIGNQEPLPSKPEAIVLWHGLGDNYNTTSMG
RIKELIENTLPDTFVHSVYIDEDPALDERRSIFGDANSELAIACEQLSQIPELSNGFAGI
GFSQGGLFMRALIEKCPNISVSTLITFGSPHLGVSELPLCPKDDDWLCKRRNAFLKSQVW
LPSVQKTVIPAQYFRDPAQYSSYTKYSHFLANINNERPEEIDEDAKERFSQIGRLVLIKF
TKDTTLVPKESAFFEEVDPHTGRTVPFPKTQLFQDDLIGLRKLFIEDKVSFYDIDDEHMR
FSDDFFVDILHEYFGAP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcagatatttagacagcttacacttgcgctttccggtctttcgataaatagcaaatgg
actccagtttctcatagtgtccacaaggagatcgggaaccaagaacctttgccgtctaag
ccggaagccatagtactatggcacggattgggcgataactacaacacaacatcaatgggc
cggatcaaagaactcattgagaatactttgcccgacacttttgttcactctgtgtacatt
gatgaagatcctgctcttgatgaaagaagatccatatttggagatgccaatagcgagtta
gcgatagcatgcgagcagcttctgcaaattcctgaattgagcaacggctttgctggaatt
ggattttctcagggtggtttgttcatgagagctcttattgaaaaatgtccgaatatctcc
gtttccacgttaatcacttttggctcacctcatttgggagttctggaacttcctctctgt
cccaaagacgatgactggttatgcaagagaagaaacgctttcttgaagagccaggtatgg
cttccgctggttcagaaaacggtgatccccgctcaatacttcagagaccctgcgcagtat
tcctcttatacgaaatactcccatttcttagcaaatatcaataacgaaaggccagaagag
atcgatgaagatgccaaagagcggttttcgcaaatcggaagactcgtgcttatcaagttt
actaaagatactacgctagtaccaaaggagagtgcattctttgaagaggtggacccacat
acaggaagaacagttccctttcctaagacccagcttttccaggacgatctcattggttta
cggaaactcttcatagaagacaaagtcagtttttatgacattgatgacgagcacatgcgt
tttctggatgactttttcgttgatattctacatgagtattttggtgcaccttaa

DBGET integrated database retrieval system