KEGG   Clavispora lusitaniae: CLUG_02696Help
Entry
CLUG_02696        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
clu  Clavispora lusitaniae
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLUG_02696
Enzymes [BR:clu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CLUG_02696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 304 aa AA seqDB search
MAVEETDTQVILTHPNNDKTTVKILKYGATVISWKENGVEQLWLSEGAKLDGSKPVRGGI
PLVFPIFGKQTDPSHPTAKLPQHGFARNSTWEFLGQVSESPVAVQFGLGPENVDPELYKL
WADGKNDFTLILTVTLSEDNLSTKIEVENTGKNDFEFNWLFHTYYRVQDVTDSLVTNLMD
STCYDQLLGETYTEKAPMLQFHEEFDRIYKQVDSHKVIQIVDKGKVLLTLERDNLPDAVV
WNPWIKKSEGMADFQPKKGYLNMLCIEPGHVSSFVKLAKGKKWAGEQKMTPSGEINVQTN
IYSV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgaagaaactgacacccaagtgatcttgacacatcccaacaatgacaaaaca
accgtgaaaatcctcaagtacggtgccacggtcatctcatggaaggagaatggagtagag
caactttggctttcggaaggcgccaaattggacggttccaagccagtcagaggtggtatt
cctctcgtcttccctattttcggcaagcaaaccgatcctagccaccctaccgcgaaattg
ccccagcacggctttgcaagaaactccacttgggaatttttgggtcaagtcagcgaaagc
cccgttgcagttcaatttggcttggggccagagaatgtggacccggaattgtacaagctt
tgggctgacggcaaaaatgacttcacacttattttgactgtgactttgtcggaggacaat
ctcagcaccaagattgaggtggaaaacactggaaaaaacgacttcgagttcaattggttg
ttccacacttactacagagtccaagatgtgacagactccttggtgaccaacttgatggat
tctacttgctacgaccagttgcttggcgaaacttatactgaaaaggcaccaatgcttcag
ttccacgaggaattcgatagaatatacaagcaggtggatctgcacaaggtcatccagatt
gtggacaagggaaaagtcttattgaccttggaaagagacaacttgcctgatgccgttgtg
tggaacccatggatcaaaaaatcggaaggcatggccgacttccagccaaagaaaggatac
ttgaacatgttgtgtattgagcctggccatgtgagctcatttgtcaagcttgccaaggga
aagaagtgggcaggcgagcagaagatgacaccatccggcgaaatcaatgttcaaactaac
atttattctgtttag

DBGET integrated database retrieval system