KEGG   Clavispora lusitaniae: CLUG_02736Help
Entry
CLUG_02736        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
clu  Clavispora lusitaniae
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CLUG_02736
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CLUG_02736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 327 aa AA seqDB search
MCGWKKSSISQKSKPIVGAYMSEFQDKRDLLKQPLHGIYIPVALIIAGTCLIDYHYLPYT
LSFVAIMCTYNFYEAWSRRRSIDPVKWNDLELIDKTIISKNSAIYRFKLNHEDEVLRIPP
GHHVACCFSIDGKDEIRYYSPISNEFDTGFFDLLVKSYPHGKVSKRFAMLKEGQTVKFRG
PVGRLEYQTNMAKEIGMVAGGSGITPILQVITKVITTPEDTTKIKLLYANETENDILLRS
ELDQIASKYPNFEVHYTLTHPPQNWTGSVGYVTKEMLEKYMPPVSPENRLFVCGPPEMKR
LLIDLTTELGWEKTTMKSDAGDQVFCF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggtggaaaaaaagctccatcagccaaaagtcaaagccaatagttggagcctac
atgtcggaattccaagacaagagagacttgttgaagcagccgcttcatgggatttatatc
cctgtggcgcttatcatagcaggcacgtgtctcattgactaccactatttgccttatacc
ctttcttttgtggcgataatgtgcacctacaacttttacgaggcatggagcagacggcgg
tcgattgatcctgtcaagtggaacgacttggaattgattgacaaaacgatcatctcgaag
aactccgccatctacagattcaagttgaaccacgaggacgaagttcttcgcattccgcca
ggacaccacgttgcttgttgtttcagcatcgacggcaaagacgaaatccgctactactcg
cccatttcgaacgagttcgacaccggtttctttgatcttttggtcaagtcgtacccgcac
ggcaaggtttcgaaacgttttgccatgttgaaggagggccagaccgtcaagttccgtggc
cctgtcggaagattggagtatcagaccaatatggctaaagaaatcggcatggttgctggt
gggtccggcatcaccccgattttgcaagtcatcaccaaagtcatcaccactccagaagac
accacgaaaatcaagttgctttacgccaacgagaccgaaaacgacatcttgttgcgctcc
gagttggaccagattgccagcaaatacccgaacttcgaggttcactacaccttgacccac
ccacctcagaactggacaggctctgttggctacgttaccaaggaaatgcttgaaaaatat
atgcctccggtttctccagagaacagactttttgtttgtgggccacctgaaatgaagaga
cttctcattgacctcacaaccgaattgggctgggagaaaaccaccatgaagtctgacgca
ggagaccaggtcttttgcttttag

DBGET integrated database retrieval system