KEGG   Clavispora lusitaniae: CLUG_02736Help
Entry
CLUG_02736        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
clu  Clavispora lusitaniae
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:clu00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 327 aa AA seqDB search
MCGWKKSSISQKSKPIVGAYMSEFQDKRDLLKQPLHGIYIPVALIIAGTCLIDYHYLPYT
LSFVAIMCTYNFYEAWSRRRSIDPVKWNDLELIDKTIISKNSAIYRFKLNHEDEVLRIPP
GHHVACCFSIDGKDEIRYYSPISNEFDTGFFDLLVKSYPHGKVSKRFAMLKEGQTVKFRG
PVGRLEYQTNMAKEIGMVAGGSGITPILQVITKVITTPEDTTKIKLLYANETENDILLRS
ELDQIASKYPNFEVHYTLTHPPQNWTGSVGYVTKEMLEKYMPPVSPENRLFVCGPPEMKR
LLIDLTTELGWEKTTMKSDAGDQVFCF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggtggaaaaaaagctccatcagccaaaagtcaaagccaatagttggagcctac
atgtcggaattccaagacaagagagacttgttgaagcagccgcttcatgggatttatatc
cctgtggcgcttatcatagcaggcacgtgtctcattgactaccactatttgccttatacc
ctttcttttgtggcgataatgtgcacctacaacttttacgaggcatggagcagacggcgg
tcgattgatcctgtcaagtggaacgacttggaattgattgacaaaacgatcatctcgaag
aactccgccatctacagattcaagttgaaccacgaggacgaagttcttcgcattccgcca
ggacaccacgttgcttgttgtttcagcatcgacggcaaagacgaaatccgctactactcg
cccatttcgaacgagttcgacaccggtttctttgatcttttggtcaagtcgtacccgcac
ggcaaggtttcgaaacgttttgccatgttgaaggagggccagaccgtcaagttccgtggc
cctgtcggaagattggagtatcagaccaatatggctaaagaaatcggcatggttgctggt
gggtccggcatcaccccgattttgcaagtcatcaccaaagtcatcaccactccagaagac
accacgaaaatcaagttgctttacgccaacgagaccgaaaacgacatcttgttgcgctcc
gagttggaccagattgccagcaaatacccgaacttcgaggttcactacaccttgacccac
ccacctcagaactggacaggctctgttggctacgttaccaaggaaatgcttgaaaaatat
atgcctccggtttctccagagaacagactttttgtttgtgggccacctgaaatgaagaga
cttctcattgacctcacaaccgaattgggctgggagaaaaccaccatgaagtctgacgca
ggagaccaggtcttttgcttttag

DBGET integrated database retrieval system