KEGG   Clavispora lusitaniae ATCC 42720: CLUG_02817Help
Entry
CLUG_02817        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00620  Pyruvate metabolism
clu00630  Glyoxylate and dicarboxylate metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01200  Carbon metabolism
Module
clu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLUG_02817
   00630 Glyoxylate and dicarboxylate metabolism
    CLUG_02817
Enzymes [BR:clu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CLUG_02817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 8498003
NCBI-ProteinID: XP_002617373
UniProt: C4Y2Q4
AA seq 558 aa AA seqDB search
MVYTSLDNVQVLGSVAKAAEHESGTAQSDILTRRALSFVVLLHRAFNKTRLALLDQRQQV
QAQIDAGKPLAFLDDPAWVQIRNDPVWRGAVPAPGLADRRTEITGPPERKMVVNALNTPV
KTYMCDFEDSSAPTWANVINGQVNLYDAVREQLDFVFKPTGKAYKVDRTPGRHIPSLIVR
PRGWHMVDKHILIDGEPVSASILDFGLYFFHNAHELVARGRGPYFYLPKMEHHLEAKLWN
DIFQVAQDYVGLPRGTIRATVLIETLPAAYQMEEIIYQLREHSAGLNCGRWDYIFSTIKR
LRNDPSKVLPNRGLVTMQSPFMAAYCRRLINICHRRQVHAMGGMAAQIPIKNDPEANDAA
MAKVKADKLREATMHFDGTWVAHPALAPLANGVFDEHMPTPNQIHVLPEEHVSAEDLSDT
KIADFAISTDGIRENLYIALCYIESWLRGVGCVPINNLMEDAATAEVSRLQLYSWVRHGV
SLADTGEKVTPDLAQKLLEEETGKLREKYSSVDHKFDLAAKYLLPEIRGDSLAEFLTTLV
YDEIVTPGEPVELASLKE
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtctacacgctgcttgacaacgttcaggttctaggctccgtcgccaaagccgccgag
cacgaatcaggcactgcccagagcgacattttgactcgccgtgccctctcgtttgtggtg
ttgctccaccgcgccttcaacaaaaccagactcgctcttcttgaccagagacagcaagtg
caagcgcaaattgacgcgggcaagcctcttgcgtttttggacgacccagcttgggtccag
atccgcaacgaccctgtctggcgaggtgccgtgcctgctccagggcttgcagaccgccgc
acggaaatcaccggccctccggagcggaaaatggtggtcaatgcgctcaacacgcctgtc
aagacgtacatgtgtgactttgaggactccctggcccccacgtgggccaatgtgatcaac
ggacaagtcaatttgtacgacgcagtgcgggagcagcttgattttgtcttcaaacccact
ggcaaggcgtacaaggtcgacagaacaccaggacgccacatcccgctgctcattgtgcgg
ccacgtggctggcacatggtggacaagcacattttgattgacggagagcccgtttcggca
tcaattctcgatttcggcctctacttcttccacaatgctcacgaactcgtggcacgcggc
cgcgggccatacttctacttgcccaagatggaacaccacttggaggccaagttgtggaac
gacattttccaagtggcccaagactatgttggattgccccgcggcacgatccgcgcaacg
gttctcatcgaaacgcttccagctgcctaccagatggaagagatcatctaccagttgcgc
gagcacagcgctggcctcaattgcggccggtgggattacatcttcagcaccattaagcgt
ttgcgcaatgatccgtccaaagtgctccccaacagaggcttggtgaccatgcaactgcca
ttcatggccgcctactgccgccgcctcatcaacatctgtcatcggcgccaggtgcatgcc
atgggtggcatggcggcgcagattccgatcaagaacgatccagaggccaacgatgccgct
atggccaaagtcaaggccgataagctccgcgaggcgacaatgcactttgacggaacatgg
gtggcgcatccagcattggcgccgcttgccaatggcgtgtttgacgaacacatgcccacg
cccaaccagatccacgtgttgcctgaagaacacgtgagtgccgaggacttgtccgacacc
aagattgccgattttgccatctccaccgacggaatccgtgagaacttgtacattgcgctc
tgttacattgagtcgtggctccggggcgtgggctgtgtgcccatcaacaacttgatggaa
gatgcagcaactgctgaagtgtcccggcttcaattgtacctgtgggtccgccacggcgtt
ctgttggcggacacaggcgaaaaagtcacgccggacttggcccaaaagctcttggaggag
gagactggcaaactcagagagaaatattcctctgtggaccacaagttcgatttggcggca
aagtacttgcttccagagatccgtggcgacagcttggcggaattcttgaccaccttggtc
tatgacgagattgtgacgccaggagagcccgtggaattggcctctttgaaagaataa

DBGET integrated database retrieval system