KEGG   Clavispora lusitaniae: CLUG_02886Help
Entry
CLUG_02886        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
clu  Clavispora lusitaniae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CLUG_02886
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CLUG_02886
   00603 Glycosphingolipid biosynthesis - globo series
    CLUG_02886
   00604 Glycosphingolipid biosynthesis - ganglio series
    CLUG_02886
   00511 Other glycan degradation
    CLUG_02886
Enzymes [BR:clu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CLUG_02886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 580 aa AA seqDB search
MFLSLISVFCILFKIGEANVRYSDPLPRPQELKWGSSGPIEIDFPLAVEINPPSGLVENA
FNRLVHSITQLKWQNPMDQDVHQTQGQIAGESSNRISRVQIRLTNTSETLQMGADESYEM
TLSGNASVIKISASVWGCLHAFSTLRQMVQYDESSSKYFFEADAYVRDWPLYAHRGIMID
SARNFLTPEVILDQIDIMELSKMNVLHWHLVDSQSWPIALSTYPEMTKGAYSSREVYTKE
DIEYIVAYAFQRGVRIIPEIDMPGHARAGYYSLNKSLLACADMWKTDHSCAYAVEPPSGQ
LEILLNETYKVVSNIYTEVSGFFKDNWFHVGADELQEKCYDNSTLTKEWFSDNGTRTFHD
LVQHWVDHALPIFESFPNRKVIMWEDIMMSSGKANHVPKSVIMQCWASSTDCARNLTDQG
YSVIMSNSDFLYLDCGYGGWLTNDDRYTETPENYRFNHGKGGSWCGPYKTWQRIYNFNIT
ANLTLEQSEKVLGAEAAMWGEQTDSTVLISKIWPRTAALAESLWSGNSDPETGLLRTGDM
TQRILVFREFLVALGYPASPLAPKFCLQNPRGCDICTSTP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttctttgatcagtgtattttgtattttattcaaaatcggagaagccaacgtg
agatactcagatcctcttccacggccacaagaattgaaatggggatcgtctggacccatt
gaaattgatttccctctcgcagtggagatcaatcctccttctggattggtcgaaaatgcc
tttaacaggttggttcattcgataacacagttgaaatggcagaacccaatggaccaggat
gttcatcaaacacaaggacagattgcaggcgaactgtcaaatagaatttctcgtgtccag
attcggttgacaaataccagtgagacattgcaaatgggagcagacgagtcgtatgaaatg
acgctttcaggaaatgcttccgttatcaaaatatccgcttcggtctggggctgtctacac
gcattttccactctccgccagatggtgcaatacgatgagagctcatcaaaatacttcttt
gaagcagacgcatatgtgcgggactggccattgtacgctcatcgaggaatcatgatcgac
agtgccagaaacttcttgacgcctgaggttattctcgaccagatcgatataatggagctc
agcaagatgaatgtgctacattggcatttggtggactcgcaatcgtggccaattgcactc
tcaacgtatccggaaatgactaaaggagcctattcgtctcgagaagtttacacgaaggag
gatattgagtatattgtcgcctatgcgttccaaagaggggtgcgtataattcccgaaatc
gatatgcctggtcatgctagagcaggctactactcgctcaacaaatcattactagcgtgt
gcagacatgtggaaaacagaccatagctgcgcatatgcggtcgaaccaccctctggacag
ttggagattttgctcaacgaaacttacaaggtagtgagcaatatctatacagaagtaagt
ggctttttcaaagacaactggttccacgtgggagcagatgagctccaggaaaaatgttac
gacaattctacgttgacaaaagagtggttttcggacaacggtaccagaacatttcatgat
ttggtccagcattgggtggaccacgcattgcctatttttgaatcgtttcccaacagaaaa
gtaatcatgtgggaagatataatgatgtccagtggcaaggcaaaccacgttcccaaaagc
gtgatcatgcaatgctgggcaagcagcacggactgtgctcgaaatctaacagaccagggg
tattctgtcatcatgagcaatagcgatttcttgtatcttgactgcggatacggcggctgg
cttacgaatgatgacaggtatacagaaactccagaaaactacagattcaaccatggcaaa
ggaggttcctggtgtgggccgtataagacatggcaacggatatacaacttcaacattact
gccaaccttacgctcgagcaactggaaaaagtacttggtgctgaagcagcaatgtgggga
gaacaaacggactctacggtcttgatttcaaaaatatggccgcgtacagcagccttggcc
gaaagtttatggagcggaaattcggatccagaaacaggcttacttagaaccggggacatg
acgcaaagaattcttgtattccgcgagttcttggtggctttgggatacccagcatcgcct
ttagcgcccaagttctgtttacagaacccacgaggctgtgacatttgtacttctacgcca
tga

DBGET integrated database retrieval system