KEGG   Clavispora lusitaniae ATCC 42720: CLUG_02886Help
Entry
CLUG_02886        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00511  Other glycan degradation
clu00513  Various types of N-glycan biosynthesis
clu00520  Amino sugar and nucleotide sugar metabolism
clu00531  Glycosaminoglycan degradation
clu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CLUG_02886
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    CLUG_02886
   00531 Glycosaminoglycan degradation
    CLUG_02886
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    CLUG_02886
   00604 Glycosphingolipid biosynthesis - ganglio series
    CLUG_02886
   00511 Other glycan degradation
    CLUG_02886
Enzymes [BR:clu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CLUG_02886
Chaperones and folding catalysts [BR:clu03110]
 Intramolecular chaperones
  Others
   CLUG_02886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 8498194
NCBI-ProteinID: XP_002617442
UniProt: C4Y2X3
AA seq 580 aa AA seqDB search
MFLSLISVFCILFKIGEANVRYSDPLPRPQELKWGSSGPIEIDFPLAVEINPPSGLVENA
FNRLVHSITQLKWQNPMDQDVHQTQGQIAGESSNRISRVQIRLTNTSETLQMGADESYEM
TLSGNASVIKISASVWGCLHAFSTLRQMVQYDESSSKYFFEADAYVRDWPLYAHRGIMID
SARNFLTPEVILDQIDIMELSKMNVLHWHLVDSQSWPIALSTYPEMTKGAYSSREVYTKE
DIEYIVAYAFQRGVRIIPEIDMPGHARAGYYSLNKSLLACADMWKTDHSCAYAVEPPSGQ
LEILLNETYKVVSNIYTEVSGFFKDNWFHVGADELQEKCYDNSTLTKEWFSDNGTRTFHD
LVQHWVDHALPIFESFPNRKVIMWEDIMMSSGKANHVPKSVIMQCWASSTDCARNLTDQG
YSVIMSNSDFLYLDCGYGGWLTNDDRYTETPENYRFNHGKGGSWCGPYKTWQRIYNFNIT
ANLTLEQSEKVLGAEAAMWGEQTDSTVLISKIWPRTAALAESLWSGNSDPETGLLRTGDM
TQRILVFREFLVALGYPASPLAPKFCLQNPRGCDICTSTP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttctttgatcagtgtattttgtattttattcaaaatcggagaagccaacgtg
agatactcagatcctcttccacggccacaagaattgaaatggggatcgtctggacccatt
gaaattgatttccctctcgcagtggagatcaatcctccttctggattggtcgaaaatgcc
tttaacaggttggttcattcgataacacagttgaaatggcagaacccaatggaccaggat
gttcatcaaacacaaggacagattgcaggcgaactgtcaaatagaatttctcgtgtccag
attcggttgacaaataccagtgagacattgcaaatgggagcagacgagtcgtatgaaatg
acgctttcaggaaatgcttccgttatcaaaatatccgcttcggtctggggctgtctacac
gcattttccactctccgccagatggtgcaatacgatgagagctcatcaaaatacttcttt
gaagcagacgcatatgtgcgggactggccattgtacgctcatcgaggaatcatgatcgac
agtgccagaaacttcttgacgcctgaggttattctcgaccagatcgatataatggagctc
agcaagatgaatgtgctacattggcatttggtggactcgcaatcgtggccaattgcactc
tcaacgtatccggaaatgactaaaggagcctattcgtctcgagaagtttacacgaaggag
gatattgagtatattgtcgcctatgcgttccaaagaggggtgcgtataattcccgaaatc
gatatgcctggtcatgctagagcaggctactactcgctcaacaaatcattactagcgtgt
gcagacatgtggaaaacagaccatagctgcgcatatgcggtcgaaccaccctctggacag
ttggagattttgctcaacgaaacttacaaggtagtgagcaatatctatacagaagtaagt
ggctttttcaaagacaactggttccacgtgggagcagatgagctccaggaaaaatgttac
gacaattctacgttgacaaaagagtggttttcggacaacggtaccagaacatttcatgat
ttggtccagcattgggtggaccacgcattgcctatttttgaatcgtttcccaacagaaaa
gtaatcatgtgggaagatataatgatgtccagtggcaaggcaaaccacgttcccaaaagc
gtgatcatgcaatgctgggcaagcagcacggactgtgctcgaaatctaacagaccagggg
tattctgtcatcatgagcaatagcgatttcttgtatcttgactgcggatacggcggctgg
cttacgaatgatgacaggtatacagaaactccagaaaactacagattcaaccatggcaaa
ggaggttcctggtgtgggccgtataagacatggcaacggatatacaacttcaacattact
gccaaccttacgctcgagcaactggaaaaagtacttggtgctgaagcagcaatgtgggga
gaacaaacggactctacggtcttgatttcaaaaatatggccgcgtacagcagccttggcc
gaaagtttatggagcggaaattcggatccagaaacaggcttacttagaaccggggacatg
acgcaaagaattcttgtattccgcgagttcttggtggctttgggatacccagcatcgcct
ttagcgcccaagttctgtttacagaacccacgaggctgtgacatttgtacttctacgcca
tga

DBGET integrated database retrieval system