KEGG   Clavispora lusitaniae: CLUG_02949Help
Entry
CLUG_02949        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CLUG_02949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 495 aa AA seqDB search
MTPVPSAKTPIKIEEGASVAEFGPEDIVSGCKVYVSKENSTRLAEILQIHYKKGHKRFYV
HYQDYNKRLDEWITPERVDFSRPMFLPEEKSEEKKQGKSSKTSKTSKTSKTSKTSKSSKA
SKDSVPPPSSEGTPLENDEMDLDNLNVQGLKSENEKVSREDEIEKLRTSGSMIQNHSEVA
RVRNLSSIILGEHIIEPWYFSPYPIELTEEDEIYICDFTLSYFGSRKQFERHRAKCSMKH
PPGNEIYRDEKVSFWEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYIMTKKSKH
GHHVVGYFSKEKESADGYNVACILTLPCYQKMGFGKLLIQFSYMLSKVENKVGSPEKPLS
DLGLLSYRAYWTDVLVKLLVERCNPHLYKKNNIHHEDRDSLSPPPRTGTSPPEITIEEIS
SITCMTTTDILHTLSTLQIIKYHKGQHIIVITDQIMALYEKLTKKVREKKKHELDPAKLQ
WTPPSFTANQLRFGW
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgtgccgagcgccaaaacgcccatcaaaatcgaagagggcgcttctgtcgcc
gagttcggcccggaagatatagtgtctgggtgcaaagtctatgtgtccaaagagaacagc
acgcggttggcagagatcttgcaaatccactataagaagggccacaagcggttctacgtc
cactatcaggattacaataagcggcttgatgaatggatcacgccagaaagagtcgatttc
ctgcggcccatgtttttgcccgaggagaagtccgaggaaaagaagcagggaaagctgagc
aagaccagcaagaccagcaaaacgagcaaaacaagcaaaacaagcaaatccagcaaggca
agcaaagactcggtcccacctcccctgctggaaggaacaccgttggaaaacgatgagatg
gaccttgacaatttgaacgtgcaagggctcaagtcagagaatgaaaaagtcagtcgagaa
gacgagattgaaaagctccgaacaagcgggtcgatgatccaaaaccactcggaagtggca
cgtgtcagaaacctatcgtccatcattttgggcgaacacatcatcgagccctggtatttc
tcgccgtatccaatcgaactcacagaggaagacgaaatctacatctgcgattttacgctt
tcgtattttgggtcgaggaaacagtttgaacgccacagagcgaaatgctccatgaaacat
ccacccgggaatgaaatctatcgtgatgaaaaggtgagtttctgggaaatcgacggacgc
aagcagcgtacttggtgccggaacttgtgcttgctctcgaagctattcttggaccacaag
acactctactatgacgttgatccgtttttgttttacatcatgacgaaaaaatcaaagcat
ggccatcatgtggtgggttacttttctaaggaaaaggaaagtgccgatggttacaacgtt
gcatgtattttgacacttccgtgctaccagaaaatgggatttggaaagcttctcatccaa
ttttcatacatgttgtcgaaagtagagaacaaggtcggatcacctgaaaagccgctctcg
gacttgggacttttgtcttaccgtgcgtactggactgacgtattggtgaagttgttggtg
gagcggtgcaatcctcatttgtacaagaagaataacatacaccacgaggaccgggactcg
ttgctgccaccgccaagaacgggcactctgccgcctgaaatcaccatcgaggagatctcc
tccatcacctgcatgaccacaactgacattcttcatacgttgctgacgcttcaaatcatc
aagtaccacaaggggcagcatattattgttattacagaccagatcatggcattgtatgag
aaactcacgaaaaaggttcgtgagaagaaaaaacatgagcttgatccagccaaacttcaa
tggacaccgccgtccttcacagccaaccagttgcggttcggatggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system