KEGG   Clavispora lusitaniae: CLUG_02956Help
Entry
CLUG_02956        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CLUG_02956
Peptidases [BR:clu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CLUG_02956
Transcription machinery [BR:clu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CLUG_02956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 515 aa AA seqDB search
MQQLTPPPDNYSHIASCTHLTQVLQSKAHDTVLDTYRQAVAISVAANPLARKHVIYSHKK
DGRPVSPAEWAQYFSTLRCTECRGSSGQAMICLQCPHVGCYNHAKTHSSRGHRFAIDSAN
GLLHCFSCGDYVSHRALHTIRKSLISKKADKSDEAGAAKVNGNTNGSADLAIADDAYTKP
PASAVHGLRGIVNLGATCFMSCILQTLLHNPLVCRHFFNNDLHFFNCDSSSRYAAPSPQI
DENSACMTCSLDAVFKEVYTSSARDGCGIATLLATAWYKNQSLAGFQEQDAHEFWQFLLG
ELHSDYERVAESAGLPQEPCRCVVHSTFAGQLESSVVCSACGAITRTVDPLMDLSLEISR
LDGKATLYDCLDQFTRHEPLDAKYRCSSCREEAQAHRALRIKALPPVISIQLKRFKHTVG
SDTASKIEARVDAPLFLNLSKYASQHDDDIDANKVYELFAVVNHVGSVSTGHYIALVKSS
GGRWFKFDDSVISLVSHEEVQATNAYLLFYIAHAV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagctcacaccgccgccagacaactacagccacattgccctgtgcacccacctc
acccaggtgctccagtccaaagcacacgacactgtgctcgacacgtatcgacaggcggtg
gcgatctcggtggccgccaacccgctagcacgcaaacacgtcatttacagccacaaaaag
gatgggcggcccgtttctcccgccgagtgggcccagtacttctccacactccgatgcact
gagtgccgcggcagcagcggccaggccatgatctgccttcagtgtccgcacgtgggttgt
tacaaccacgccaagacgcattcgagtcgtggccaccgcttcgccatcgactctgcaaat
gggttgcttcactgttttctgtgtggagactatgtcagccaccgcgcattacacactatc
cggaagctgctcattagtaaaaaagccgacaagtcagacgaggcaggtgctgcaaaggta
aatggcaacacaaatggaagcgcagatttggcaatagcagatgacgcatacacaaagccg
ccggcgtccgcagtgcacgggctccgtggcatcgtcaacctcggcgccacatgcttcatg
agctgcattctccaaacgttgctccacaacccgctcgtgtgccgccatttcttcaacaat
gacctccattttttcaactgcgacctgctgtcacggtatgcggcgccttcgccccaaatc
gacgagaatctggcgtgcatgacctgtctgttggatgccgtgttcaaggaagtatatacg
tcctctgcccgcgacgggtgtggcattgctacgcttctagccacggcctggtacaaaaac
caactgcttgcaggcttccaggagcaggatgcgcatgagttctggcagttcttattgggt
gagctccatctggactacgagcgtgtggccgaaagcgccggcttgccgcaagaaccgtgc
cgttgcgtcgttcactcgacttttgcgggccagctcgaaagttcggttgtttgcagtgcc
tgcggtgctataacccgcacggtggacccgctcatggacctttctctcgagatctcgcga
ctcgacgggaaagcaactctttacgactgtctcgaccagttcacgcggcacgagccattg
gacgctaaataccgatgcagctcgtgccgtgaggaggcacaggcacaccgagctctccga
atcaaagcacttccgcctgtgatcagcattcagctcaagcggtttaaacacaccgtggga
agcgacactgcctcaaaaattgaagcgagagtggatgcgccgcttttcctcaacttgtcc
aagtatgcgtcacagcatgatgacgacattgacgcaaataaagtgtacgagctttttgct
gtggtgaatcatgtcggactggtcagcacaggccactacattgcgcttgtaaaaagcagc
ggcgggcgctggttcaagtttgacgatagtgtgatctcccttgtctctcacgaagaagtc
caggcaacaaatgcgtaccttctcttttacattgcgcatgccgtgtga

DBGET integrated database retrieval system