KEGG   Clavispora lusitaniae: CLUG_02959Help
Entry
CLUG_02959        CDS       T01149                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
clu  Clavispora lusitaniae
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:clu00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 110 aa AA seqDB search
MPAKFEKGSEKKGATLFKTRCLQCHTVEEGGPHKVGPNLHGVFGRKSGEAAGYSYTDANK
KKGVVWSEQTMSDYLENPKKYIPGTKMAFGGLKKPKDRNDLITYLASATK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctaaattcgaaaaaggttctgaaaagaagggtgctactctcttcaagaccaga
tgtttgcaatgtcacaccgttgaggagggcggaccacacaaggttggtccaaacttgcac
ggtgtttttggcagaaagtctggtgaggctgctggttactcttacaccgacgccaacaag
aagaagggtgttgtctggtccgagcaaaccatgtctgactacttggagaacccaaagaag
tacattccaggtaccaagatggctttcggtggtttgaagaagccaaaggacagaaacgac
ttgatcacctacttggctagtgccaccaaataa

DBGET integrated database retrieval system