KEGG   Clavispora lusitaniae: CLUG_02963Help
Entry
CLUG_02963        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CLUG_02963
Peptidases [BR:clu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CLUG_02963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1279 aa AA seqDB search
MIDNDDKIIDIDSDCDIVGEKPPDTIVLSASDADSADDSDPDAMDDMDACAAENEPSKAT
SQSTQSSLYPKADEYEKLASRLMKPLPEYPVVGEAHYTWTISDWSSVRREDKVRSGRFEC
GGFSWNMLLFPRGNNDTVSLYMEPHPSESHGPNWYVCAQFALDMWNPEHPESHYPSSSSH
RFNKNETDWGFSAFITGRDLANPAKCNQPHAILENNTLNITGYVRVIDDSATGVLWHNFV
EYDSKAHTGYVGLNNQGATCYLNSLLQSYYTTRVFRDLVCQIPTDDGAGSKAVPLALQRI
FYLMQSSNEPVGTLELTKSFGWDSSDAFTQHDVQELNRVLMDRLETAMKGTPIEKKLNDV
FVGKMKSYIKCVNVPYESSRVEEFWDIQLNVKGFRNLQQSFENYIEIEMLEGENKYQAGE
EYGYQDAKKGVVFESFPPVLHLQLKRFEYDFMVDDLVKIDDLYEFPDKIDLSPYLDTDLP
PAVRNQNWNYKLHGVLVHQGSISNGHYYAMIKPEANSQTWLRFDDDKVWKVTPSQVFQEN
FGAQELSPIQLRSLTRSERNEYLIRRATSAYMLVYYRESEMEFVLPEKLASIPDHVSEQI
NREREELANWEKKKREAMFYTNVKLATVDNFVCYNGFDTYPDPAKPKFYDPNIFDKRAYP
PVLSVKKDMTFASLYKLVAQELGYEKENALGTEDDAISIDDDTDLSKFPFRLLTVKHRNN
RTSRPDSAVPPEMYESTINDVYTQCFKRKYDELVFFVEESRKELSHITPPTTKTAPEVFD
FEALADRIVSNQDAKPAHFDDSDVKIFIKYFDPVLNEVRGVTYASVPKDTVVSELMEPIN
NVLGFDESTPLEFFEEVSSTRIEPVDSSVTLEKNELGTGDILTVQIANVESSAVEKKFSN
ARDYYDFLSTRFHIMVKPCKAGDDEEDSNFVADEQTPETESTNGETTEAQEIQLAKEMSR
SFDMWVSTSYTYQELAEEIAMKLGNNVNPEHLRLFVLNNSGSRLPLSSNLVLSQIFNKQV
AVSTTIQFEYEVLNITLEEYENMKSVKIYWLNTILQFHLLDMLVPKTSTVADLIKKVIDK
MDVPKEHWSNLLVWAGQEYKYADLVKFDRSIEDLNSSYEYYCGYFPAEVEILTSHDMFKR
FDENYTSESDITDETLRSEFQLAQRYLKSLNIIPVFHFHKSTSYVHSKPFVFAVFPDELF
EDTKTRLRKKLGLGIQAFEKIKIALADSNDKGRYLDMDKADLNLLQEISKFDSHVSLALD
HPDRTPRRVNPYERGISIR
NT seq 3840 nt NT seq  +upstreamnt  +downstreamnt
atgatcgataacgacgacaaaatcattgacattgatagcgactgcgacattgtcggagaa
aaaccgcccgacaccatagttcttagcgccagcgacgctgacagcgccgatgattccgat
cccgacgccatggacgacatggatgcgtgtgccgctgaaaacgaacccagcaaggctact
tcacaactgacgcagctgctgttgtaccctaaagcagacgagtacgaaaaacttgcgctg
aggctcatgaaaccacttccagaatatcccgtagtgggcgaggctcattacacgtggacc
atctccgactggagctcagtacgccgtgaagataaagtacgcagcggccgttttgaatgc
ggtggctttctgtggaatatgctcttgtttccgagaggaaacaatgatacagtgtcactt
tacatggaaccgcatccgtccgagtctcatggacccaactggtatgtgtgcgcacagttt
gcgttggacatgtggaatccagaacatccagaatcccattacccgtcaagttcgagccac
agattcaacaagaacgaaacggactggggtttttcggccttcatcacaggccgcgatctt
gcaaaccccgcaaagtgcaatcagccccatgcgattctcgaaaacaacacattaaatatc
acgggctatgtacgtgttattgacgactctgctacaggggtattgtggcacaatttcgtg
gaatacgattctaaggcgcacacgggttacgtgggtttgaacaatcagggagctacatgc
tacctcaattcgttactccaatcgtactataccacacgagtatttcgagacttggtatgc
caaattcctaccgacgacggtgctggcagcaaagccgttcctttggcattgcagcgtatc
ttttacctcatgcaactgtccaatgaaccggtcggaacgttggaacttactaaatcattt
ggctgggattcttcagacgcttttacacagcacgatgtccaggaactcaaccgtgttcta
atggaccgactcgagacagccatgaaaggcacgcccattgaaaagaaattgaacgatgtt
ttcgtcggcaagatgaaactgtacattaagtgtgtcaatgtgccatatgaatcttcacgt
gtggaggaattttgggatattcaactcaacgtgaaagggtttcgcaatttacaacagtca
ttcgagaattacatcgaaatcgaaatgcttgagggagaaaacaaatatcaggcaggcgag
gaatacggttatcaggatgcaaagaagggtgtggtattcgagtctttccctcctgtgttg
catttacaattgaaacggttcgagtatgattttatggtcgatgatctcgtgaaaatagat
gatttatacgagtttccagacaaaatcgacctcagcccatatttggatactgatttaccc
ccggcagtgcgcaaccagaactggaactataaacttcacggtgtacttgtacaccaggga
agcatttccaacgggcactactatgccatgataaaaccagaagccaacagccaaacgtgg
ctccgttttgatgacgataaggtgtggaaggtaaccccatcgcaagttttccaagaaaac
tttggtgctcaggagttgtcacctatacagttacgtctgctcactcgcctggagcgcaat
gagtacttgatccggagggcaacttccgcatacatgttagtttactaccgtgaatcggag
atggagtttgtacttcctgaaaagcttgcttccatcccagaccacgtatctgaacaaatc
aatagagagcgcgaggagcttgccaattgggagaagaagaagcgtgaagccatgttctac
acaaatgtcaagctcgcaacagttgacaactttgtatgctacaatgggtttgacacatac
ccagatccagcgaaaccgaagttctacgacccgaacatctttgacaaacgtgcataccct
ccagtgctctctgtgaagaaggatatgacgtttgcctctttatacaaacttgtggcccag
gagttaggctatgagaaggagaacgctctcggtacagaagacgatgcgatctccattgat
gacgatactgacctctccaaatttccattccgtttgcttacagtcaaacatcgcaacaat
agaacaagcagacccgactccgctgttcctccagagatgtatgaatcaaccattaatgac
gtgtacacacaatgcttcaaacgcaagtacgacgagttagtgttctttgtggaagaactg
cggaaagagttgagccatatcacccctcctacaacaaaaactgctcctgaagtatttgat
tttgaagcattggccgatcgtatcgttagcaatcaagatgcaaaacctgcgcattttgac
gatagcgatgtcaagatattcatcaagtatttcgatcccgtgttgaatgaagttcgtgga
gtcacttatgctagcgtacctaaggacactgtggtatcagagttgatggagccaatcaat
aatgtcctcggcttcgatgaactgacacctttggaatttttcgaagaagtatcactgact
cgcatagaaccagtcgattcaagtgtcacgctcgagaaaaacgaactaggcactggagac
attttgaccgtccagatcgccaacgtcgagagtagcgcggtggaaaagaagttcagtaac
gctagagattactatgacttcttatcgacaaggttccatattatggtaaaaccttgcaag
gcaggagacgatgaggaagacagtaactttgtcgctgacgaacagactccagaaacggag
tccactaatggagaaactacggaggcacaagaaatccaattggctaaagaaatgagtaga
tcttttgatatgtgggtatctacgtcatacacttaccaagaattggcggaagaaattgct
atgaaacttggcaataatgttaacccggagcacttgcgtctctttgtgctcaacaacagc
ggcagccgacttccattgtcatcaaatttggttttgtcacaaattttcaacaagcaagtg
gcagtgtctaccacaattcagtttgagtacgaagtactcaacatcacattggaagagtac
gagaacatgaaatcagtcaaaatttactggctcaatacgattcttcaattccatctcctt
gacatgcttgtaccgaaaacgagcacggttgcagatctcattaagaaagtgatcgataag
atggatgtgcctaaagaacattggagcaatttacttgtatgggctggccaagaatacaag
tatgcagacctcgtcaagtttgaccgatctattgaagatttgaatagcctgtacgagtat
tattgcggatatttcccggcagaagtggaaatattgactagccacgacatgtttaaaaga
ttcgacgagaactatacatccgagtctgacattacagatgagactctccggctggagttc
caattggcccaacgctacttgaaactgttgaatattatcccagtgttccatttccacaaa
tcgacatcttatgttcacagcaagccctttgtgtttgcagtatttccggacgagttgttt
gaagacacgaagactcgattgcgcaaaaagttgggtcttggcatccaggcgttcgagaaa
atcaaaatcgctctcgccgacagcaatgacaagggccggtacctcgacatggacaaggca
gacttgaatttgctccaggagattctgaagtttgactcgcacgtgtcgcttgctttggac
cacccggaccgtactccacgtagggtgaacccatacgagcgtggtatctctatccggtag

DBGET integrated database retrieval system