KEGG   Clavispora lusitaniae: CLUG_03263Help
Entry
CLUG_03263        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
clu  Clavispora lusitaniae
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CLUG_03263
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CLUG_03263
Enzymes [BR:clu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CLUG_03263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 902 aa AA seqDB search
MSAFSDVKADKRFSISSSAANFLTSSIQSATDLISRSRKNSDPLRTRNISIDDDPMRKKI
LKLRQNDVSDDSANEFCINDDNENDGDNEIDDGNENDTDDDIPTDRRHHLSRTLVQNKTD
IGYPDVGVDDYIYENDVKESIENMASFEVPSVFLKQGMLLLKISHKSKKRILFKVDPSNF
KFVYKQTSKSKTYEFLVDDIRSIMARENANIYREEFGISKEFERRWITVVFFNHHKNKLK
TLNLIADTSRDLKKLLFVIEGFKKLKDNISETLLVNLGDLDEVEKTIVSGKAESTIKQPK
KQLSLSDVLKFSKRLNVNVNTDFLEGLYHSVRSDNKTGIDFKEFKNFVKLLKKREDISPI
WKSLTKGKEFMYLEDFISFVTEIQGECYDLEKASRIFRRFSSNEDSSAWQEEDWTAFLLS
KYSNPLIEEHMDDSYFKHPLNEYYILSSHNTYLIGRQVAGDSSVEGYMKALHKGCRCLEI
DIWNNQSDPEAEPIVNHGRTFTNGISLPSVLKAIKKYAFVASPFPVILSLEIHCSNTAQL
KVVKLLQEILGDALVQEPINSESTLPNPDKLKYRFLVKVKKSTPFSAIGVDETGKLVSSS
TTASFSESNDNFSSKSSLKLRRKSTNNIIDTLSDLGIYVQGTKFRNFSLPESKTFNHCFS
LSEKSANSMIKDDGKRNALDKHNRKFLMRVYPSKIRLKSSNFIPMNYWAHGVQMVATNWQ
TYDLGQQLNESFFAGSYGYVLKPHYLRHALLKSTMRRTDIYGAQKIKFCIDIISAQQLPK
PTNSAAINPFIIVEIIGANSVTWDRSSTVGATPIVAGNGHNPCWNSRYAGVAESDHHFMF
LRITVHSSTSATTVDDTKEICTLLVKFSSMKQGYRYYPLNDPCGERLLYSTIFMKVNWCT
VK
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctttctctgatgtgaaagcagataagcgatttagtatctcaagctctgcagca
aatttcctaacctcttccattcaatcagcaactgatctcatatctcgttccaggaagaat
tcggatcccttgagaactcgaaatatttccatagatgatgaccctatgaggaaaaagata
cttaaattacgacagaatgacgtctctgatgacagtgcaaatgagttttgcattaatgat
gataatgagaatgatggtgacaacgagattgatgatggtaatgagaatgacactgatgat
gatattccaactgacaggaggcatcacttgagcagaacgcttgttcaaaataagacggat
atcggttatcctgatgtaggtgttgatgattatatttatgaaaacgacgtcaaggaatct
atagagaatatggcttcgtttgaggttccttctgtctttttgaagcagggcatgttactt
ctcaagatttctcataaatcaaaaaagcggattttattcaaagtggacccttctaatttc
aaattcgtttataagcaaacttctaagtcaaagacatacgagtttttggtggatgacata
aggagcatcatggcaagagaaaatgccaacatataccgtgaagagttcggaatttctaag
gagtttgaaagaaggtggattactgttgtgtttttcaaccatcacaaaaataagttaaaa
actctcaatctcatagcagacactagtcgtgatctcaaaaaactacttttcgtgatcgag
ggattcaagaaactcaaagacaacatctccgaaactcttttagtgaatttaggagactta
gatgaggtggaaaagacaattgttagcggaaaagcggaaagtaccattaagcagccaaaa
aagcaacttagtctttctgacgtactaaagtttagtaaaagactaaatgtcaacgtcaat
actgatttcttagaaggcctatatcattcagttcggagtgataacaaaacaggaatcgat
tttaaagagttcaagaacttcgttaagttgctcaagaagagagaagacatctctccaata
tggaaatcattaacaaaaggaaaggagttcatgtacttagaggatttcatttcattcgta
acagaaattcagggagaatgctatgacttagaaaaggcttcaagaatattcagaagattt
tcgtcaaatgaagatctgtctgcatggcaagaagaagattggacagccttcttattgtcg
aagtattcaaatccacttatcgaagaacatatggacgactcttacttcaaacacccattg
aacgaatactatattctctcatcacataacacctacttaatcggaagacaagttgctggg
gattcttctgttgagggatacatgaaagcacttcataagggctgtaggtgcttggaaatt
gatatctggaataatcaaagcgatcctgaggccgagcctatcgtcaatcacggtcgaact
ttcactaacggtatttcgctacctagcgtcttgaaagctatcaagaagtatgctttcgtt
gcatccccctttccagtgattttaagcctcgaaattcattgctctaatacggctcaattg
aaagtcgtgaagttgttacaagagatactaggggatgccttggtacaagaaccaatcaac
tcagaaagtactcttcccaaccctgacaaactaaaatatcgatttctcgtgaaagtcaaa
aagtcaacaccgttttctgcaattggtgtagatgagaccgggaaactcgtgagcagttcc
acaacagcatcatttagcgagagtaatgataacttttcaagtaaaagctccttgaaactc
agaagaaagagtacaaacaacatcatcgataccctaagcgatctaggaatttatgtccaa
ggtacaaagtttcgcaatttctcgcttcctgaatcgaagacgtttaatcactgtttctct
cttagtgaaaaatctgccaattctatgattaaagatgatggaaaaagaaatgctctcgac
aagcataaccgaaagtttttaatgagagtctatccttcaaagattagattaaagtcatcg
aactttattcccatgaattattgggcccatggggtacaaatggtagctactaactggcag
acctacgatttgggacagcaattgaacgaatcattctttgctggatcttacggttatgtc
ttgaagcctcattatttgcgacatgcattattgaagtcgaccatgagaaggacagatatt
tacggcgcacagaaaatcaaattctgcattgacataatcagtgctcaacagttgcctaaa
cccacgaattccgcagcaataaatccttttattatagttgaaattattggggctaattca
gttacatgggatcgcagctctactgttggagctacgccgatcgtggctggaaatggtcat
aatccttgttggaacctgagatatgcaggggtggcagagtctgaccatcatttcatgttc
ttgcgcattacggttcattcttctacatcagcaacaaccgtagatgacacaaaggaaata
tgcacactcttagtcaagttttctagtatgaaacaaggctatcgatattatccccttaat
gacccatgtggagaaaggttgctctactccaccatatttatgaaggtgaattggtgtact
gtgaagtaa

DBGET integrated database retrieval system