KEGG   Clavispora lusitaniae ATCC 42720: CLUG_03354Help
Entry
CLUG_03354        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00514  Other types of O-glycan biosynthesis
clu00515  Mannose type O-glycan biosynthesis
clu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    CLUG_03354
   00514 Other types of O-glycan biosynthesis
    CLUG_03354
Enzymes [BR:clu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     CLUG_03354
Glycosyltransferases [BR:clu01003]
 O-Glycan biosynthesis
  O-linked Man type
   CLUG_03354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT PMT_4TMC MIR DUF569 O_Spanin_T7
Motif
Other DBs
NCBI-GeneID: 8497025
NCBI-ProteinID: XP_002616113
UniProt: C4Y5C0
AA seq 741 aa AA seqDB search
MPAAEKSKGLPLGYKDGKLRPFFSSKVNPGLQAQTKFGPEDRFYLFVIISCAFLVRFYKL
PEPPMVVFDETHFGGFAKEYFEGEFFLDVHPPLVKLIYYWIALLFGWNGKFEFENIGDVF
DDNVPYVAMRSFSAACGVMTVGLTYCILRASACRRLVALFGASLVLLENSIATQSRLIML
DSPLIAFTALTVFAFKKFEMSSPFTREWKQWLFLTGIGLALTVSTKLTGLFTFAWVAGWS
MYQLWCYAGDLDVTYKMLFRHIYHRLFRLVLIPFTIYCGVFSLHFMSLPKNGTGSGILSP
QFKAEFEDSDKLRNTAVDVSYGSTVTIKHHRLEQYLHSHEYPYKTGSHEQQVTMYGFQDD
LNSEWIIERHGTIMEGQLDSRFRPIKDGDTVKLYHKRTKKYLRANDVRPPISEHDYSNEV
SCDGNRTTTQDVNYEWKVRIVGRKPHSENELPLRKLRATESVFQLIHKGTRCILMGHDTK
LPEWAFHQSQVLCVNDPTIANTLFYIEYNNHPVIDKDTETYPRVKLPRKSFFSKLLEYHQ
AMWRINKGFTTKHEYSSQPIQWPFVTRGINFFTNGHGDKQLSDETGSHIYFLGNLTVYYG
GILVVLLFGIRFAFYALVHLNPFKLVNEPAFVTNNYITMLEFVSGWFINYFPYFHMSRQL
FAHHYLVSVFFLVLAIAQFVEHQMRMHPMGGFVLLLSIEACAALCFGKTKPLIYGLNWTV
EECQKAKWFPTWDFDCMAYSQ
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccgcagaaaagtctaaggggcttcctttggggtacaaagacgggaaactaaga
ccttttttctcatccaaggtcaatcctggcttgcaggcccaaacaaaattcggaccagaa
gatcggttctacttgttcgtcatcattagttgtgcctttttggtacgcttttataaactt
ccagagcctcctatggtagtttttgacgagacccatttcggaggctttgcaaaagaatat
ttcgaaggcgaattctttctcgatgtccatccaccattggtcaaactcatctattactgg
atcgcattgttgttcgggtggaacggtaagttcgagtttgaaaacattggtgatgttttc
gacgataacgtgccgtatgttgccatgaggtcattttctgcagcttgcggtgttatgact
gttggtctcacgtattgcatcttgagagcatcagcatgtcgtcgcttggtagcattattt
ggcgcatctctagtccttctcgagaactccatagccacccagtccagactcataatgctc
gatagccctttgattgccttcacagcgctaacagtgtttgcgttcaagaaattcgagatg
tcatctcctttcactagggaatggaagcagtggttgttcctcaccggaatagggttggca
ctcactgtatcaacaaaactaactggtctttttacttttgcatgggtcgccggctggtcc
atgtatcagctttggtgctatgctggcgacttagacgtcacctacaaaatgctcttcaga
catatttaccacagattgttccgactcgtgcttattccattcacgatctactgtggtgtt
ttctcgctccatttcatgtcattgcccaaaaacggcactggctcgggtattcttctgccc
cagttcaaagcggagtttgaagactcggacaagcttagaaacacagctgtggatgtctct
tatggaagcacagtgacaatcaaacatcacagattggaacaatacttgcattctcacgaa
tatccctacaaaactggatcccacgaacaacaagtgaccatgtacggttttcaagatgat
ttgaatagtgagtggatcattgaaagacacggcactatcatggaaggccaattggattcc
agatttcggcccatcaaagacggcgacacagtgaagctttaccataaacgcaccaagaaa
tacttgcgtgccaacgacgtccggcctccaatttccgagcacgattactccaacgaagtc
agctgtgacggcaacagaaccaccactcaggatgtcaactacgagtggaaagtgaggatc
gttggaaggaaacctcactcggaaaatgagcttcctttgcggaagttgcgtgctaccgaa
tcggtctttcaattgatccacaaaggaacccgttgcattttgatgggacatgacacgaaa
ttgcccgagtgggcattccatcagagccaggtattgtgtgtcaatgatccaacaattgcc
aacacgttgttttacatcgagtataacaatcatcctgttattgacaaagatacagagaca
tatcctcgtgtgaaactccctcggaaactgtttttcagtaaactattggaataccaccaa
gccatgtggagaatcaacaaaggtttcacaacaaaacatgaatactcatcgcagcctata
cagtggccatttgtcacccgaggaataaactttttcacaaacgggcatggtgacaagcag
ttgtctgatgagacaggaagccacatttacttcttgggcaaccttactgtctactatggt
ggtattttggttgtgcttctatttggaatccgttttgcattctatgcacttgtgcattta
aaccccttcaagcttgtgaatgaaccagcattcgtgacgaataattatattactatgcta
gagtttgtcagtggttggttcatcaattacttcccctattttcacatgtcacgccagttg
tttgcccatcactatttggtgagcgtctttttccttgttttggccattgcacagttcgta
gaacaccagatgcgcatgcatcccatgggaggcttcgtgcttttactttctattgaggcg
tgtgccgcattgtgcttcgggaaaaccaagccattgatatacggtctaaactggactgtc
gaagaatgtcagaaagcaaagtggttcccgacctgggactttgattgcatggcgtacagc
caataa

DBGET integrated database retrieval system