KEGG   Clavispora lusitaniae: CLUG_03364Help
Entry
CLUG_03364        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
clu  Clavispora lusitaniae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1414 aa AA seqDB search
MSSQVVYFGPRPLQPLNGTMRHGFDTDHNSDRFLRTLANTFYIYFDDKRHIANGRPLSAS
MKRLPALARHFQPIADWKVMRERQKTISAVLVLCLNLGVDPPDVMKTHPCAKREAWCDPS
AFSDTKKALEAIAKGLQAQYETLSLRTRYKQSLDPCVEDVKRFCNTLRRNAKDERILFHY
NGHGVPRPTASGEIWVFNRGYTQYIPISLYDLQTWLGAPVVFVWDCSGAGNIVHSFKKFV
QRRIDDDNEGNHDLSAPSPTSAYLDSLQLAACKSNDTLPMSPALPADLFTCCLTCPIDMS
LQWFIMRSPLEKSHYARLPRNSAGNVIVPGKLTDRRTPLGELNWIFTAITDTIAWTSLPR
PVFKRLFRQDLMVAALFRNFLLAKRIMPHFNCTPVSDPPLPDAVRNHPMWDSWDLAIDQV
FAQLLEKELSTDPDQSQNQGPNLTQPPLSNSHQSAIVNSNSAAVATAPGAGQPSLNYQHS
TFFEQQLTAFDLWLKYAGPSTKEPPEQLPIVLQVLLSQVHRLRALILLSKFLDMGPWAVY
LSLSIGIFPYVLKLLQSPAQELKPVLIFIWARIMAIDYRSTQQELCKDKGYNYFYLILNS
TPHNPIGAPGAPGGLNTSNPGSVVVNDDHKAMSAFILTLFIKDFKNGQRLCFSIELVANC
LRFISTSENPLLRQWCCLLLSQLWLRYPDGKWIIYKDGHLNRLLDLVADPIPEVRTSIIV
ALTTFLSEPEDTESPKRSRDDFSSAPSVSADLRKDELKQQDLKLANVILRLLGDGSSIVR
REIVFFIGRFIKIYPNFFLVVAFNQLEEEIVLIDNPNNLQEFRKKSPAYGSIFSSIWKAL
LILSEDPHLEVKQLAEILIDSVMVKLNQSELSGLVKEMQDYLLSKSYININDNFKSSKPI
VNRPMALHNGPKRQASSGSVLNRQNTLTISGTGRSRSYSQGDSNDHSDASSISSKLRNLS
ISRIFKSFNLNEETDINNFTKILNPGPVSSHYGQEYKPKTPRYEPRPDMKEPELPEESGF
FEYSCEYFQEPQMSKTEIEQPGSEEYVKRLWRRNRNEQVIQETQPQKKMAIRGDWNRDTT
VLNNKTQPKLIKFMQFEKLLVATDDKDNVSVWDWEARDIVTKFSNGNPFGTKITDLKFLN
EDDLPLVMTGSSDGVVKIYRNFHYEGGDEKPVELVTAWRALTDLLLTSKSTGLISEWQQS
RGSLLVSGDVKVFRVWDAQRELCVLDIPARSTSSITSITSDQVAGDVFVAGFDDGSLRVY
DRRLDARESMVQLWQNGRGGAKDIGRGSIRNVHMQRGGFRELVSGSADGYVNLWDIRNTE
PVATFTTPEQGLRCIDVHEHAPIICTGSKWVNMWTTSGDMIATLKNPHDGYLTNRTSNYL
ANVTFHPHRMMVTTNFNQDGHINVYKCTDIMSEY
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgcaggtggtgtattttggcccgcggccactccagccgttgaacggcaccatg
cgccacggctttgacacggaccataacctggaccggttcctccgcacgctcgccaacacc
ttctatatttatttcgatgacaagcgtcacatcgccaacggccgcccgctcagcgccagc
atgaagcgactcccggcgctcgcacggcatttccagcccattgccgactggaaagtcatg
cgggagcggcagaaaaccatcagtgctgttctcgtactctgcttgaaccttggcgtggat
cctccagacgtgatgaaaacgcacccgtgtgcaaagcgcgaggcgtggtgtgatccgctg
gccttttcagacaccaagaaggcgctcgaggccattgccaagggcttgcaagcgcagtac
gagacgctcctgttgcgtacgcgatacaagcagtctttggacccgtgtgtcgaagatgtc
aagcggttctgcaacacattgcgccgcaacgccaaggacgagcgcatcttgttccattat
aatggtcatggcgtgccgcggcccactgccagcggcgagatctgggtcttcaaccgaggc
tacacccagtacattccaatcctgctctatgacttgcagacgtggctcggcgctccggtg
gtgttcgtgtgggactgcagcggcgccggaaacattgtgcacagcttcaagaagtttgtg
cagcggcgaattgacgatgacaacgagggcaaccacgacttgagcgccccgctgcccacg
tctgcgtacctagatctgcttcagctcgccgcctgcaaaagcaacgacaccttgcccatg
agcccagctttgcccgcagacttgttcacctgctgcctcacctgtccaatcgacatgtcg
ctccagtggtttatcatgcggctgccgctagagaaaagccactacgcccggctcccacgc
aactcggccggaaacgtcattgtgccaggcaagctcaccgaccgccgtacgccgcttggc
gagttgaactggatattcaccgccattactgacaccattgcgtggacactgttgccgcgg
cccgtgttcaaacggctcttccggcaagatttgatggtggctgcgctcttccgtaacttt
ttgttggctaagcggattatgccccacttcaattgcaccccagtgagcgatcctcccttg
cccgacgctgtgcgtaaccatccgatgtgggatctgtgggaccttgcaatcgaccaggtg
tttgcgcagttgctcgaaaaggagcttctgacagacccagaccagagccagaaccaaggc
ccgaatctcacccagccaccgcttctgaatctgcatcagagtgcaatcgtgaatctgaac
ctggcagcagtagccactgcgcctggagctggccagcccagcttgaattaccagcattca
acctttttcgaacagcagctcacggcgtttgatctttggctcaaatatgccggtccgtcc
accaaggagcctccagaacagctaccgattgtcttgcaagtgttgttgtcccaggtgcat
cgccttcgtgcgttgatcttgctttccaagtttttggatatgggcccgtgggctgtatac
ttgtcgttgtccatcggaatcttcccgtacgtgctcaagttgcttcaaagcccggcacag
gaattgaaacccgtccttattttcatctgggctcgtatcatggctattgattaccgcagc
acacaacaagagctctgcaaggacaagggttacaactatttctaccttattttgaattcc
actccacataaccctatcggtgccccaggagctccaggtgggctcaatacctcgaacccg
ggctccgtcgtggtcaacgatgaccataaggctatgagcgcatttattctcacacttttc
atcaaagacttcaagaatggccagcgtctctgcttctccatcgagctcgtggcaaattgt
cttcgttttatatcgacaagtgaaaatccattgttgcgtcaatggtgctgtttgcttctc
tcccagctttggctcaggtacccagacgggaaatggataatttacaaagacggccacttg
aatcgcctcttggatttggtagccgatcctattcctgaagttcgtacatccatcattgtg
gctctcacaacatttttgtctgagcctgaagataccgagctgcctaagagatctcgtgac
gatttttcgtccgcacctagtgtcagcgctgatcttcgcaaggatgagttgaagcagcag
gatttgaagcttgcgaatgtgattttacgcttgctaggcgatggatcgtctattgttcgt
cgcgaaattgtgtttttcattggtcgcttcatcaaaatctacccgaacttcttcttggta
gtagcattcaatcaattggaggaggaaattgtattgattgacaatccaaacaacttacaa
gaattccgaaagaagtctccagcatacggttcaatctttagctccatctggaaagcgctt
ttgattttatctgaagatccacatcttgaagtaaaacaattagcagagatattgatagat
tcagtcatggtgaagctcaaccagagcgaactttcaggcttggtcaaggaaatgcaagac
tatcttttaagcaagtcctacatcaacatcaatgataacttcaagtcgtcaaaaccaatc
gtcaaccgtcccatggcattacacaatgggccaaaacgacaggcttccagtgggtcagtt
ctaaacaggcaaaacactcttacaatcagtggtacaggcagatcgcgttcttactcacag
ggtgactcaaacgatcacagcgatgcgtcatcaatttcttccaagttgcgcaatttgagc
atctctcgtattttcaagtccttcaacctaaatgaggaaacagacatcaacaacttcaca
aaaatcttgaatcctggacctgtctcaagccattatggccaggagtacaagccaaagact
cctcgatacgaaccacgcccagatatgaaagaacctgagcttcctgaagagtctggattt
tttgagtacagctgcgagtactttcaagagcctcaaatgtcgaaaacagagattgagcaa
ccaggatccgaagagtacgtcaaacgcttatggcggcgtaacagaaacgagcaggttatt
caagagacgcaaccacagaagaaaatggctattcgtggcgactggaatagagacacaacg
gtgttgaacaacaagacacagccaaaactcatcaagttcatgcagtttgaaaagttattg
gtggccacagatgataaggacaacgtttcagtctgggactgggaagcccgcgatattgtg
acaaagttttccaacgggaacccctttggcacgaaaatcactgacttgaagtttttgaac
gaagacgacttgcctttagtaatgacgggctcatccgacggagtggtaaagatctatcgt
aacttccactatgaaggaggtgatgagaaacccgttgagcttgtcacagcttggagagca
ttgaccgatcttcttcttacatctaaaagtactggtctcatcagtgaatggcagcaatcg
cgtggttcgcttttggtcagtggtgacgtgaaggttttccgtgtatgggacgcccaacgt
gaactttgtgtgcttgatattccggctaggtctacatcttccatcacgtcaatcacatca
gaccaggtggcgggagacgtctttgtcgcaggctttgacgatggaagtttacgggtttat
gaccgccgacttgatgcccgcgagtccatggttcagctttggcagaatggccgaggtggc
gctaaggacattggcaggggctcgattagaaacgttcacatgcagcggggtgggttccgt
gagcttgtcagcggttcagccgacggatatgtcaatctatgggatatcagaaacaccgag
ccagtggcaacattcaccacaccagagcaaggcttgcggtgcattgatgttcacgaacat
gctccaattatttgtacggggtccaagtgggtcaatatgtggacaacgtcaggcgacatg
attgccaccttgaaaaacccacacgacggctatctcactaatcgtacgctgaactacttg
gctaacgtgacctttcatccacatcgcatgatggtaacaaccaacttcaaccaagacggg
catatcaacgtgtacaagtgcacagatataatgtcagagtactga

DBGET integrated database retrieval system