KEGG   Clavispora lusitaniae: CLUG_03386Help
Entry
CLUG_03386        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
clu  Clavispora lusitaniae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CLUG_03386
Enzymes [BR:clu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CLUG_03386
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CLUG_03386
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     CLUG_03386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 781 aa AA seqDB search
MSDKVHISGLQGTAIVGHDHWQKPVPQPIVIDVTFSTDFAQASDADDLHFSLNYAVISNK
IARYLTSTHQRNFHSLGGLGQALMSELADERAACSAVNLKVAAPKLDIRSVVSYSSSIIE
SEANTDAKENSSSFPVEGVYRIEGLRALALIGVFTFEREAKQYVVVDVDMGVKGHLDVSR
ISEGLHSFLERTNFKTVEALIKACAQWVLSFAPETNWAAVRVAKPNAIVYTDSVGVSGKY
TRADFADMSKTGLESPESPYGAKSAADAISTTPFDLPVTSPTSFSGQHTVYVAFGSNEGS
PTANIARALQLINDHPQMHVDAVSALYVSKPMYVTAQSDFYNGVARVVVRDMAPHDVLSA
LKHIEYNELSRVKVVDNGPRTIDLDIVLYGKACVNTQDLIVPHRAMLSRTFVLAPLCELL
PPDFVHPVTAEPVHDHWAKLRATPADSALQESPVLEQVVPGSGERSLRLGPQRATHIMAI
FNATPDSFSDGGMHCDLTEAEIQAVARGMVEQGATIIDVGGCSTRPGSTQPSADEETRRV
VRVVRSIRAARDLDSVLLSIDTYRAGVAQAALAEGADIINDVSMGTHDAAIFDVVASSGC
GYVLSHSRGTPATMAKLTDYSYSGDDNLVEYWIGAQEALPETDRAVVQGVCRELARQVCA
AEARGVRKWQMILDPGVGFAKNTQQNLSLLRHASRLKQYAQLDTNANRYTSFQGMPVLLG
TSRKKFLGEITGTSRADERVVASAAAVVASVQQGADVVRVHDVRAAREAAQTADAIFRGV
H
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataaggtgcacatctctggccttcaaggtacagccatcgttggccatgaccac
tggcagaagcctgttccgcaacccatagttatcgatgtgacgtttagtactgactttgcc
caggctctggacgcagatgatcttcacttttcgttgaactacgcagtcatctcaaacaag
atagcacgctatctcaccagcacacatcagcgtaatttccactcgctcggcggccttgga
caggctcttatgagcgaactagcagatgagcgtgccgcgtgctcagccgtgaatcttaag
gttgccgctccaaagttggacatacgttctgttgtaagctactcctcaagcataatagag
tcagaggccaacacagatgctaaagaaaactcgagcagcttccctgttgagggggtttat
cgtattgaaggcttgcgtgcattggcattgatcggtgtctttactttcgaacgcgaggcc
aaacagtacgtcgttgtggatgtggacatgggtgtcaaagggcacttggatgtatctcgc
atttcggaaggattgcatctgttcctcgagagaaccaatttcaagactgtcgaagcgctt
atcaaggcatgtgcgcagtgggttctactgtttgctccagaaaccaactgggctgcagtc
cgtgtggccaaacccaatgccatcgtatacaccgacagcgttggcgtctctggaaaatac
acgcgggcggactttgcggacatgctgaagactggccttgaatcacccgagtctccgtat
ggagcaaaatctgccgcggatgcgattagcaccacgccgttcgatcttccggtaacttct
cccacatcgttttcgggacagcatacggtgtatgttgcctttggttccaacgagggcagt
cctactgccaacatcgcacgtgcgttgcaacttattaatgatcatccccagatgcatgtg
gacgctgtgctggcgctatatgtctccaagcccatgtacgtcacggcccagtcagatttc
tataacggcgttgccagagtggtggttcgcgacatggcaccgcacgatgtgctctcagcg
ctcaagcatatcgagtacaacgagctttctcgggtcaaggttgttgacaacggtccacgc
accatcgacttggacattgtgctctacggcaaggcgtgtgtcaacacacaagacttgatt
gtgccgcaccgtgccatgctcctgcgcacgtttgtgcttgcgccgctctgcgagcttctc
ccgcccgattttgtgcatcctgtcactgcggagccggtgcatgatcactgggccaagttg
cgtgccacgcctgctgattcggccttacaagaatcgccggtgctcgagcaagtagtgccg
ggatctggagagcgcagtctccgccttgggccgcaacgggcaacgcacatcatggccatt
ttcaacgccacgccggactcgttcagcgacggcggcatgcactgcgacttgacggaagcc
gagatccaggcggtggcacgtggaatggtggaacaaggcgccacgatcatcgatgtgggc
gggtgctccacgcggcccggcagcacgcagccttcagccgacgaagaaacacgccgtgtg
gttcgtgtggtgcggtcgattcgcgccgcgcgcgacttggactcggtccttttgtccatt
gacacataccgtgccggtgtggcacaggctgcgcttgcggaaggtgccgatatcatcaac
gatgttctgatgggcacacacgacgcggccattttcgacgtggtggcgctgtcaggctgc
ggctacgttctctcgcactctcgtggaacgcccgccaccatggcgaagctcacagactat
tcatattcgggggacgacaatttggtcgagtactggatcggcgcgcaagaggcattgccc
gagacagaccgcgcggtggtgcaaggtgtgtgccgcgaactagcgcggcaggtttgtgcg
gccgaagcgcggggcgtgcgcaaatggcagatgattcttgacccgggcgtgggctttgcc
aaaaacacccaacagaacctttcgcttttgcgccacgcgctgcgtctcaagcagtacgcc
cagctcgataccaatgcaaaccggtacacgtctttccaaggcatgcctgttcttttgggc
acaagccgcaagaagttcttgggcgagatcacgggcacttcgcgcgccgacgaacgtgtc
gtggcctcggccgctgctgtcgtggccagcgtgcaacagggcgcagacgttgttcgcgtg
cacgacgtgcgggcggcgcgcgaggcagcgcagacggcggacgccattttccgcggcgtg
cactag

DBGET integrated database retrieval system