KEGG   Clavispora lusitaniae: CLUG_03416Help
Entry
CLUG_03416        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K05546  
alpha 1,3-glucosidase [EC:3.2.1.84]
Organism
clu  Clavispora lusitaniae
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
N-glycan biosynthesis, high-mannose type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:clu00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:clu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 933 aa AA seqDB search
MNPVALLFFSLLWARVFAVKEYLFKNCAQSGFCHRNRHLATQNFESPYFVDPASIVHENG
SVAGTIYKKLPSNDVVALPFDISLLVGDSVRFQIDENRQPTGPASKLNPRRFRAAETAFD
GPENEKQQVLSKDQVSVSDNGIVLVYGPDNEFSARLDFAPLKLAVSRHGKVQAVFNARKL
LNIEHWRPQKENSAHLWPYESEFDMFSDSFGDSRDDTKPFGPESVAADVRLIGFDHVFGL
PEHADSFSLKDTTDSEWPYRLYNVDIFEYETESRMPMYGSIPLLVGVKPDAAAGIFWVNA
ADTFVDIKKGHSNTDKDAEKSKGHHSLVDTHWMSETGTVDIVIILAATPEEINAKYGQLT
GHVSLPQEFALGYHQCRWNYNDEKDVLDVHAQMDAHGVPYDTIWLDIEYADKKKYFTWDK
EAFPDPEGMAAELARTGRNLVVIVDPHLKTGYSVSEGVEKLGISIKDRANSTFKGHCWPG
ESVWIDAMNPNAQAYWDELFSPGSVLLGATSNVHLWNDMNEPSVFSGPETSMPKDTLHWG
DFEHRAVHNAWGQRFHELTFESLEKRTQYSKRPFILTRSYFAGSQRSAAMWTGDNMARWE
YLRASLPMVLTSNAVGMPFAGADVGGFFGDPSNQLLVRWYQTGLFYPFFRAHAHIDSRRR
EPWIPGEPFTSHIRDAVRLRYRLLPTLYTLFHDASVTGSPVWRPMVWEHPDSDCYDVEDQ
FYLGQSGLLVKPVTEENANSVDIFFPANERYYDFTSGHVADVPPVALSEAGKLSRTVSLE
DIPMYVKGGSVFALRDRYRRSSKLMKADPFHLVVGLDANGVASGKLYLDDGESYDYKNGQ
YTETKYEMVAGQLKSQVNGDPNYALSSSLRIEKITILGAQDISSIEAKQDGRSWSVEFVQ
HKHYVEILNPRVGAAANWTINVVHMPRHEKDEL
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgttgccctcctttttttttctcttctctgggcccgggtcttcgccgtgaaa
gagtaccttttcaaaaactgcgctcaatccggtttctgccaccgcaatcgccatttggcg
acccagaatttcgaaagtccatacttcgttgatccagcatccattgtccacgaaaatggc
tctgtggcaggaacaatatacaaaaaattgcctctgaatgacgtggtggccttacccttt
gatatttccttgcttgtgggtgatagcgtacgctttcagattgacgaaaacagacagcct
accgggccggcgctgaagttgaatccaaggcgattccgagccgctgagactgcgtttgac
ggccctgaaaacgagaaacaacaagtgctttccaaagatcaagtcagtgtgctggataac
ggcattgtgcttgtttatggcccagacaatgagttctccgcccgtcttgactttgcacct
ttgaagttggctgtttctcgccacgggaaggtccaggcagtttttaatgcccgaaaattg
ctcaatatcgaacactggcggccgcagaaggaaaactcggcccacttgtggccctacgag
tccgaatttgacatgttttccgactcctttggcgacctgcgcgacgacaccaaaccgttt
ggcccagaatcggtcgctgcagacgtcaggcttatcggctttgaccatgtgtttgggctt
ccggaacatgctgacctgttcagcttgaaagacactacggattcagaatggccgtaccgg
ctctacaatgtggacattttcgagtacgaaacagagtcccgcatgcccatgtatggctcg
attcctttattggttggtgtcaagcccgatgccgccgcaggcatattttgggtgaatgcc
gcagacacttttgtggacatcaaaaagggacactccaacactgacaaagatgcggaaaaa
agcaagggccaccattctttggtcgacacacactggatgtctgaaactggaactgtggac
atcgtcatcatcttggcagcgacaccagaagaaatcaacgccaagtatggccagttgacc
ggccacgtttcgcttccgcaggagtttgctttgggctaccaccaatgccgctggaactac
aacgacgagaaagatgtcttggatgtccatgcgcagatggatgcccatggcgtcccttac
gacactatctggcttgacatcgagtatgccgacaagaaaaagtactttacgtgggacaaa
gaagcattccccgacccggaggggatggcggccgagttggcccgaacggggagaaacttg
gtggtgattgtggacccacatttgaaaacaggctatagtgtgagtgaaggcgtagagaag
cttggtatttcgattaaggaccgggccaactccactttcaagggccactgctggcctggc
gagtctgtgtggatcgatgcaatgaacccgaacgcccaagcatactgggatgagcttttc
ctgcccggcagcgttcttcttggagcaacatcgaacgttcatctctggaatgatatgaac
gagccgtctgtcttcagcggaccagaaacctccatgcccaaggacacacttcactgggga
gattttgagcacagagctgtacacaatgcttggggccagcggttccacgaacttactttc
gagtcgcttgagaaacgcacacaatacagcaagcggccgtttattctcacacgttcgtac
tttgcgggatcccagcgctcggctgcaatgtggacaggcgacaacatggcccgctgggag
tatcttcgggcgtcgttgcccatggtgcttacttccaacgccgtgggaatgcctttcgcc
ggagcagacgtgggaggattctttggcgacccgtcgaaccaattgctcgtgcggtggtac
cagactgggctcttctatccgtttttccgggctcacgctcacatcgactccagaagaaga
gagccatggattccaggcgaaccgttcacgtcgcacatccgagatgcggtacgtttgcgc
taccgcttgttgcctacgctctatacgcttttccacgacgccagtgtaacaggaagtccc
gtgtggagacctatggtttgggaacatccagactccgattgctatgatgtcgaggatcag
ttttatcttgggcaatcgggccttcttgtgaaaccggtgactgaggaaaacgccaacagc
gtcgacattttcttccctgctaatgaacgttattacgacttcaccagtggacatgtggct
gatgtgccacctgtcgctttatctgaagcaggaaagctttcgcgcacagtgtcgctcgaa
gacataccgatgtatgtgaagggtggttctgtgtttgccttgcgtgatcggtaccggcgc
tcgtccaagctcatgaaggctgatccgttccacttggttgtgggcttggatgcaaacggt
gtggcttcggggaagttgtatctcgacgacggagagtcgtacgattataagaacggtcag
tacactgaaaccaagtatgagatggtggcaggtcagttgaagagccaggtgaatggcgat
ccaaactatgctctactgctgagtcttcgtattgagaagataaccatcttgggcgctcag
gatatcagcagtatcgaggcgaaacaagacggccgtctgtggtctgtggaatttgttcag
cacaaacattatgtggagatattgaacccacgagtcggagctgcagcaaattggaccatc
aatgtggtgcatatgccaagacatgagaaagacgaactctag

DBGET integrated database retrieval system