KEGG   Clavispora lusitaniae ATCC 42720: CLUG_03483Help
Entry
CLUG_03483        CDS       T01149                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  
translation initiation factor 4E
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CLUG_03483
Messenger RNA biogenesis [BR:clu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CLUG_03483
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CLUG_03483
Translation factors [BR:clu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CLUG_03483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 209 aa AA seqDB search
MSEDLTKKTEELSLDSEKTVLSSKEEFTAKHPLNSKWTLWYTKPQTNKSETWSDLLKPVI
TFSSVEEFWGIYNSIPVANQLPMKSDYHLFKEGIKPEWEDEQNAKGGRWQYSFNNKRDVA
QVINDLWLRGLLAVIGETIEDDENEVNGIVLNIRRANIRVGIWTKDCDESKLVTIGERFK
KVLKLGDDQKVEFMSHDTFNAKGNAQITV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagatttgaccaaaaagaccgaagagttgtccttggactcggagaaaaccgtc
ttgagcagcaaggaagaattcaccgccaagcacccattgaacagcaaatggaccttgtgg
tacaccaaaccccaaaccaacaagtccgaaacatggctggatttgttgaagccagtgatc
acattttcttctgtcgaagagttctggggcatctacaactctattcctgtggccaaccag
ttgcctatgaaatcagactaccacttgtttaaagagggcattaagccagagtgggaagat
gagcaaaacgccaagggaggaagatggcaatactccttcaacaacaagagagatgttgct
caggtgatcaacgatttgtggttgagaggcttgttggccgtgattggcgagaccatcgag
gatgacgaaaacgaagtcaatggcatagtgttgaacatcagaagagccaacatcagagtg
ggtatttggaccaaggactgcgatgagtccaagttggtgaccattggcgagagattcaag
aaggtgttgaagttgggcgacgaccaaaaggttgagttcatgtcgcacgacactttcaac
gccaagggtaacgcgcagatcaccgtctaa

DBGET integrated database retrieval system