KEGG   Clavispora lusitaniae: CLUG_03483Help
Entry
CLUG_03483        CDS       T01149                                 

Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
clu  Clavispora lusitaniae
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CLUG_03483
Messenger RNA biogenesis [BR:clu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CLUG_03483
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CLUG_03483
Translation factors [BR:clu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CLUG_03483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 209 aa AA seqDB search
MSEDLTKKTEELSLDSEKTVLSSKEEFTAKHPLNSKWTLWYTKPQTNKSETWSDLLKPVI
TFSSVEEFWGIYNSIPVANQLPMKSDYHLFKEGIKPEWEDEQNAKGGRWQYSFNNKRDVA
QVINDLWLRGLLAVIGETIEDDENEVNGIVLNIRRANIRVGIWTKDCDESKLVTIGERFK
KVLKLGDDQKVEFMSHDTFNAKGNAQITV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagatttgaccaaaaagaccgaagagttgtccttggactcggagaaaaccgtc
ttgagcagcaaggaagaattcaccgccaagcacccattgaacagcaaatggaccttgtgg
tacaccaaaccccaaaccaacaagtccgaaacatggctggatttgttgaagccagtgatc
acattttcttctgtcgaagagttctggggcatctacaactctattcctgtggccaaccag
ttgcctatgaaatcagactaccacttgtttaaagagggcattaagccagagtgggaagat
gagcaaaacgccaagggaggaagatggcaatactccttcaacaacaagagagatgttgct
caggtgatcaacgatttgtggttgagaggcttgttggccgtgattggcgagaccatcgag
gatgacgaaaacgaagtcaatggcatagtgttgaacatcagaagagccaacatcagagtg
ggtatttggaccaaggactgcgatgagtccaagttggtgaccattggcgagagattcaag
aaggtgttgaagttgggcgacgaccaaaaggttgagttcatgtcgcacgacactttcaac
gccaagggtaacgcgcagatcaccgtctaa

DBGET integrated database retrieval system