KEGG   Clavispora lusitaniae: CLUG_03498Help
Entry
CLUG_03498        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
clu  Clavispora lusitaniae
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:clu00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 753 aa AA seqDB search
MSSSGISTGEKSSVRSRKAGNVASERSPAEEHDISAAEKYEESTAQSLAKLESWLAPLLF
TITSFALRMYRISLNNGVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMMVGLSGWLAGYN
GSWDFPSGEIYPDYIDYTKMRLFQATFASLIVPLAYYTSKEIGFSIPATWLFTTMVTFEL
SYITLGKFILLDSPLLFFTAATLFTFTRFSNFNNKKQEFSRKWWKWILLTGISIGCTCST
KMVGLFVTSLVGIYTVVDLWNKFGDKSISWKKYAVHWATRIFALIIVPFLVFLLSFKIHF
DLLYKSGTGDANMSSLFQANLLNSDVGGGPRDVTIGHSFVTLKNQGLTGGLLHSHVQTFP
EGSKQQQVTTYSHKDSNNNWIFQRPRPQPFYDTETNSEAEYVLDGMTVRLIHPQTGRNLH
THDISAPVQKSEYEVACYGNMTVGDLKDNWIVEVMESYGKEDALKLHPLTTSFRLKSEVM
NCYLGVTGNSLPQWGFRQGEVVCFKNPFKKDKRTWWNIENNRNAILPDAPEDFQLPKTNF
FKDFIQINLAMMATNNALVPDDDKQDDLASKFWQWPTLHSGIRMCSWADDKVKYFLIGSP
ATTWTSSVGVVLFCFITLYHLIRWQRQINDFETASKLKKFVMGGIYPMFGWGLHFMPFVI
MGRVTYVHHYLPALYFAMLVFTYEVEAFTQPLARSQKPAMKVLYWGIFIALYALMILTFW
HFRWISWGMEGPKTDWSHLDLLPSWRVGNENYI
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatctggcatcagcaccggcgaaaaatcgtctgtccgttccagaaaagcggga
aatgtcgcttctgaaaggtctccagccgaagaacacgacatttccgccgctgagaaatac
gaagagtccacggcccagtctcttgcaaaattggagtcgtggttggcacctctacttttc
acaatcacatccttcgccctcagaatgtacagaatcagtttgaacaatggtgttgtctgg
gacgaagcccattttggaaagtttggttcttactacttgagacatgagttttaccatgac
gtgcacccacctttggggaaaatgatggttggcttgtctggttggttagcaggatacaac
ggctcctgggacttcccatccggtgaaatctacccagattatattgactacactaagatg
agacttttccaggctacattcgcctcgttaattgttccattggcctattacacctccaaa
gaaattggcttctccattcctgcaacgtggttgttcaccacaatggttacatttgagttg
tcctacattactttgggcaagttcatcttgcttgactctcctcttttgtttttcactgcg
gctaccttgtttaccttcactcgcttcagcaactttaacaacaagaagcaagaattctcg
cgcaaatggtggaagtggattttgcttaccggtatctccatcggatgtacttgctctacc
aagatggttggtcttttcgttacctccttggtgggcatttatactgtggttgacttgtgg
aacaaattcggcgataagtctatttcgtggaagaaatacgctgtccactgggctacgcgt
atcttcgccttgattatcgtgcctttccttgtctttttgttgtccttcaagatccacttt
gacttgttatataagtcaggaacaggtgatgccaacatgtcttctttgttccaagccaac
ttgcttaattctgatgtgggaggtggtccaagagatgttacaattggtcactcttttgta
accctcaagaaccaaggtttgaccggtggtttgttgcactctcacgttcaaactttccct
gaaggttctaaacaacaacaggtgacgacatattcccacaaggattccaacaacaactgg
attttccaaagacctcgccctcaacctttctatgacacagagacaaactcagaagctgag
tatgttttggatggcatgaccgttagattgatccacccacagacaggtagaaacttgcat
actcatgacatttcggcgccagtacaaaagtctgaatacgaagtcgcttgttatggaaac
atgactgttggagacttgaaggataactggattgttgaagttatggaatcttacggtaaa
gaagacgcgttgaaattgcaccctttaaccacatcttttagattaaagagtgaggtcatg
aactgctatctaggtgtcacaggtaactccttgccacaatggggtttcagacaaggtgag
gttgtctgtttcaagaacccattcaaaaaggacaagagaacttggtggaatatcgaaaac
aaccggaatgcgattttgcctgatgctcctgaggacttccagttgccaaaaacgaacttt
ttcaaggactttattcaaatcaacttggccatgatggctactaacaatgctttggttcct
gacgatgacaagcaagatgacttggcttccaagttctggcaatggccaacattgcactct
ggtatcagaatgtgctcctgggccgacgataaggtaaagtactttttgattggttctccg
gctacaacttggacttcttctgtcggtgttgtcttgttttgcttcattactttgtaccac
ttgatcagatggcaaagacaaatcaatgattttgaaacggctctgaaactcaagaagttt
gtgatgggcggcatctatcctatgtttggctggggtttgcattttatgccctttgttatc
atgggtagagtcacgtacgtgcaccactacttgccagcgttgtatttcgcgatgttggtc
ttcacgtacgaagttgaagcctttactcagccattagctcgctctcaaaagccagcaatg
aaagtcttgtactggggtattttcattgcgttgtatgctttgatgatactcacgttctgg
catttcagatggatctcttggggtatggaaggtccaaagaccgattggagccatttggac
ttgttgccctcctggagagtgggtaacgaaaactatatataa

DBGET integrated database retrieval system