KEGG   Clavispora lusitaniae: CLUG_03551Help
Entry
CLUG_03551        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
clu  Clavispora lusitaniae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 235 aa AA seqDB search
MADTKRVIPIESNPEIFSSLAHNIGLSPILAFQDVYSITDPDLLAFLPRPVMGVTMLFPI
TEKYEEYRKHQDEINLNQSKGAHWFKQTVANGCGFYAILHILANLPRDLIIENSILNKLL
LSQLSDELSVEEISSLVEMLEQNIQLDSNYGNQGQTAAPSAEEAVEYHFISFVRGKDGHL
YELDGRRTGPVDLGPSDNEDIINDKKLLDKIQFYMDNTEERQRDNFALMALTPSL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacaaaacgagtgattcctattgagtctaacccagagattttcagctccttg
gctcataacattggcctttccccaatattggcgtttcaggatgtctactccattaccgat
ccagatttattggcctttttgccccgcccagttatgggtgtcacgatgttgtttcccatc
acggaaaagtacgaagagtaccgcaaacatcaggatgaaatcaaccttaatcaatccaaa
ggtgctcattggttcaagcaaaccgttgctaatgggtgtggtttctatgcgattctccac
atactagcgaatttgcctcgtgacttgataatcgaaaatctgatcttgaacaagttactt
cttctgcaactctctgacgaattgagtgtggaagaaatatcatctttggttgaaatgctt
gagcaaaacatacagcttgactccaattatggtaatcaaggccaaactgcggcacccagt
gcggaagaagctgtggaataccatttcatctcttttgtcagaggaaaagacggccacttg
tatgaattagatggaaggcgcacaggaccagttgacttgggtccctcggataatgaagat
ataattaatgacaaaaagttattggacaaaatccagttctatatggataataccgaagaa
cgccaacgtgataattttgcattgatggctttaacgccatctttgtga

DBGET integrated database retrieval system