KEGG   Clavispora lusitaniae: CLUG_03563Help
Entry
CLUG_03563        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
clu  Clavispora lusitaniae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1210 aa AA seqDB search
MSEELQIPQMASHASSDQTEPPHIPPVEHEPSPPSAGDAVDNANVDIASLQAEWRRLMDT
KPVDGDVCYVIPRDFIQRVLSPTDCACLKDFASFVGKLDNTRILDAAGNLFPLGEEKVET
AFVSPELYRSFQCHFGSLGPPVIRNVLVDAEGNAVLERFPPYFLVHTLCKNAPTTRAISH
IGGLESHSKCAFSLSQTKTFKDLVDTIRNLMNVDKNSSLRVWFITTDNVEELSANIPVSS
FINKIQHKKIVTPQVMTFSLQSQGIRSSRLHLVVEVSEKSSKKFILDQAVASTSLSSFDM
NKITTTGGNLGLSNLGNTCYMNSALQCLVHVPEINFYFFYDLFEKELNRSNPLGNSGDVA
VAFSNLLHKLFDYPGSSTSSVTPREFKYTIGRYSSMFHGYQQQDSQEFLSWLLDALHEDL
NRIYDKPYCEKPELKDEDVENPQAIVDLAKECWNLHKKRNDSVIVDLFTGMYQSTLLCPV
CYKKSVTFDPFNDLTLPLPVNKKWYHEFTIVDLSGSYLDSFIMKLEVELSKSSTYEDLVA
YLSKHLGVPRDFLFLFEIFRNFFYKDFQEDNYQQSFLPINEIIGDDDAIFVYIIPYTPDD
RIIPVINVAKDEDRSYDITEPFGIPLFIVLNKQSECSRLSQIEKKVSLIANRLSTANSSE
IKSQATIVGGEASDEVMTEASETSQEEAKESSASITDSQSDAKYDIRYYREGNPKFSSSY
RRHARHHVGQPEKNFAEKILNIPHERPHFNNLPLLIEAFSKPQRQNSRLSTERSDSLEPK
LDDQNPDANLKVLSDDEDGNLCTPSIIGDDEQRSIGENTDNETNWDNLDSMFSSVDNLPP
IENSKSAEGTSEKDSDPEKNEIDGILQGNELLVIDWKSHSYQDYFADTDKRAWENLDYVS
NPELEENKRKLAAQQRTTISLYDCLRNFSTPEVLGDQDLWYCPRCKEHRRATKTIQVWST
GDILTFHLKRFQSARSLSDKINMVVDFPIEGLDMTDYVTSSQISKQPLIYDLIAVDNHYG
GLGGGHYTASVKNFRDNKWYYFNDSRVTPLEDPKECVTGAAYLLFYKKRSSNQFAGGESV
GQFIDKGRNEFEQKLSKLKDSLLQVTEELGLYREQEAVESANSLEVENNEEEDLYEDAED
DLQKVPALASAKKSRSPVTEQNMKFENQRKQRLISKGSDSPRSVNINLNYSSSTSNLASP
GGSTDDERDV
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggagcttcaaataccgcaaatggctctgcatgcctcttctgaccagaccgag
cctcctcacattcctccggtggagcatgagccttcgccaccgctggctggtgatgctgtg
gataatgccaatgtcgatattgctctgttacaagccgaatggcgtcggctaatggacaca
aaaccggtagatggcgatgtatgttatgttataccacgcgatttcattcagagggtactt
tctccgaccgattgcgcttgtctaaaggattttgcatctttcgtgggaaagttggacaac
acgcggattcttgatgcagcggggaacttgtttccactcggagaagagaaggtggaaaca
gcattcgtgtcacctgagttgtatcgtctgttccaatgccactttggcctgcttgggcct
ccagtaattcgcaatgtattggttgatgcagaaggtaatgcggttttggaaagatttcct
ccgtattttcttgtccacacattgtgcaaaaacgctccaacaacaagagcaatctcacat
attggaggcttagaatcccattctaaatgtgcatttctgctctcgcaaaccaaaacattc
aaggatttggtcgatacaattcgcaatctcatgaacgttgacaagaactcaagcttaaga
gtctggtttatcaccactgacaatgtggaagaattgtcagcaaatattcctgtctcgtct
ttcatcaacaagatacagcataagaaaatcgtgacgccacaagtcatgacgtttctgtta
caaagccagggtatacgctcctccaggcttcatttggtggtggaagtaagtgaaaaatcc
agcaagaagtttattttggatcaagccgttgcttcgacgtccctttccctgttcgacatg
aataaaatcacaacgactggtggcaacttgggactatccaatctcggtaacacttgctac
atgaactctgctttgcaatgtcttgttcacgttcccgaaatcaacttttatttcttctat
gacttgtttgagaaggagttgaacagaagcaaccccttggggaatctgggcgacgtagca
gttgcattttctaatttacttcataagttgttcgattatcctgggagctcgacaagcctg
gttacgcctagagaattcaagtacacaattggtcgttactcatctatgtttcacggctat
cagcaacaagactctcaagagtttctaagctggcttttagatgctcttcatgaagatctc
aatcgaatttatgataaaccgtattgtgagaaaccagaactcaaagatgaggatgtggag
aatcctcaagcaatcgtggacttggccaaagaatgttggaatctacataaaaagagaaat
gattctgtgattgttgatctcttcacaggaatgtatcaatcaacattgctctgcccggta
tgctacaaaaagtctgtcacttttgatcctttcaatgatttaactttgcctttgcctgtt
aacaagaagtggtatcacgaatttaccattgtcgatttgagcggctcttatttagactcc
ttcattatgaaacttgaagttgagctctctaaatcctctacgtatgaagatttggtggct
tacttgagtaaacatttgggtgtccctcgagatttcttgttcctttttgagattttcagg
aatttcttttacaaagattttcaggaggataactatcaacagtcatttttgcccatcaat
gagattatcggtgacgatgatgccatctttgtgtatatcatcccatacacacctgatgat
cgaatcattccggtgatcaacgttgcgaaagatgaggataggtcgtatgatataacggaa
ccatttggtattccgttattcatagttttgaacaagcaaagcgaatgctcaaggttgctg
cagatcgagaagaaagtctcactcattgcgaaccgtttatctacggccaacagtagtgaa
atcaaatcacaggcaaccatcgtggggggtgaagctagtgacgaagtgatgactgaagca
tctgaaacgtcacaggaagaggctaaggagtcttcggccctgataaccgatagtcaaagc
gacgctaagtacgatataaggtattacagggaaggaaatccaaaattcagtctgagctat
cgcaggcatgcccgtcatcatgtgggtcagccggaaaagaattttgcggaaaagattttg
aatataccgcatgagagaccacattttaataatttaccactcttgatcgaggcgtttctg
aagccacaacgtcaaaatctgaggcttagtactgaaagaagcgatagtcttgaacccaag
ttggatgatcaaaaccccgatgcaaacttgaaagttttgagtgatgatgaggatggtaat
ctttgtactccttccataataggagatgatgaacagcgtctgattggtgagaacactgac
aatgaaaccaattgggataatcttgatagtatgttttcttcagttgacaatttaccacca
attgaaaattctaaatctgctgaaggcacttctgaaaaagattcagatcctgaaaagaac
gaaatagacggtatcctccaaggaaatgagcttttagtgatagattggaagagccatagt
taccaagactatttcgcggatacggataaacgagcatgggagaatcttgattacgtttct
aatccagagttagaggagaacaaacgcaagcttgcggcgcagcagagaacaactatttcc
ttgtatgactgtttacggaatttcagtacgcctgaggtattgggtgatcaagatttatgg
tactgtcctaggtgcaaagagcatagaagagctaccaaaactattcaggtgtggtccacc
ggcgatatcttgacatttcacttgaagcgctttcagagtgcacggtcattgagcgataaa
atcaatatggttgttgacttccccattgaaggtttagacatgacagattatgtgacttcc
agtcaaatctcaaagcaaccactcatatatgatttgattgccgttgataaccattatggt
ggattaggtggaggtcattacactgcctcggtcaaaaactttagagacaacaaatggtac
tatttcaatgatagccgcgtcactccattagaagatccgaaggagtgcgtgactggagct
gcgtatttgttgttttacaagaaacgaagcagtaatcaatttgctggaggagagtcagtg
gggcaatttattgataagggccgcaatgaatttgagcaaaaattgagtaaactcaaagac
ctgttgcttcaagtcacagaagaacttggtttatacagagaacaagaggccgtagagagt
gcaaacctgttagaagtggaaaataatgaggaagaagacctctatgaggatgctgaagat
gatctacagaaagtgccagcgcttgcatcggcgaagaaatctagatctccagtcacagag
caaaacatgaaatttgagaaccagcgcaagcaaaggctaatttcgaaaggctcggacctg
cctcgctccgtgaacatcaacttgaattattcttcatctacgtcaaacttagcttctcct
ggtggatctaccgacgatgagagagatgtgtga

DBGET integrated database retrieval system