KEGG   Clavispora lusitaniae: CLUG_03608Help
Entry
CLUG_03608        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
clu  Clavispora lusitaniae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1261 aa AA seqDB search
MPLDQAEDIPTIIGAKAVSSASTPIEPSKEQKHKSNNPFTNGKFAQGSNSDSLTSTSVAN
IESLSPFEYIGTNISKNELRLRPFKTSNRILDDLKYTPALFKMLSQGRLQKPITSFLNSS
PFAYKDILPHILQLERYETLILNNAVDYIPSVEKHELKDCNVTVSTVRGLIVSSSNDEIN
HFKIVILEKSPPLSRIPIDKHEYHQIEKSMLSADDLNIMNDKSNASSNLIDDAFFKSGNS
LVNHIMRVSVYTSEFTKEDLLSSIDSNLIKERYLRGIESSPDSQLSIDSIPGPVHCLQTL
LKVLKGPINLPATEPIHTISKSKTLLDVKIDLRLLFEKFSFTLGDDEDSLIPPNLSLNPS
LKEAYIRKAYELVFIGKSLKTSKVNDFDTKYSFSDNMAQVHSILSEIDKHSALANSRSRE
TNRYSFFIALSCCVFYQDELIIRCYENTVVSDPRNKMAYVDCFKKIMENRSSGSTGRLAS
YHNSQYLKGLMYGYSDYEAALKILGIELIPSDDDVEIDAIIEMYKAATNSDPKNYAYFNN
QVEKIAKIRDSLELKDFLANEIIPMSIALNELRIEEVTEDEVVITAFEFRLNDVMQEVNF
NSNSPEIRILQRSLYSVALNRKSYILLNYIEKKFPDLQQKMNITFSDALRILEVTADSTD
FEIITNFQEKLAKSSLHDPVDVRALRASLKRVAEERKSNILMSFLEQGKIDPSLQPPELW
PTGLDNIGNTCYLNSLLQYYFCIKPLRDMILNFDEANVKIDPNSARKIGGRKVEESELNR
SFQFIYRLQKLFNEMISSKERCVQPSKELAYLAFLPLSQPIDFKDNSELPLPGGDDGVID
TEFEPIIVDSESPELMSADTDMDKDNQDLIVLDSTCTSPNLESAPSLNMVEVDSMHVEDN
QVDIATGKKILAISSDQIESTIELGRQQDVTECIENVTYQIETALEPEKIESDGEQFDLI
KKLFCGKTKQTITPLGEEKANVRVSVERFFSLIINVGDHPKDIYDALDNYFNEDSVELEE
GEVKKALTIQELPQVLQFHVQRVLFDRERLVAYKSLEVIPFGETIYVDRYLETDDEEIIA
KRQEVFDWKSEMKKLYAEKDSILMVDSETKLSALDALKATLKYLETNTLKSELNCVKQST
IDSIRSQIHLLELKLQAIENKLISLQDKVSTQFDSYKQVGYSLFAIFIHRGEASYGHYWI
YIKDPHRNIYRKYNDETVTEVPYSEVFNFTTTNTATPYYMVYVKSELMDEYIEPLKREIK
C
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atgccacttgatcaggcagaggatattcccacaattataggcgctaaggctgtctcctcc
gcatctactccaatagagcctctgaaagagcaaaaacacaagagcaataatccgtttaca
aatgggaagtttgcgcaaggaagcaattccgattctttgacgagcactctggttgcaaat
atcgaatcactttctccattcgagtacattggaaccaatatatctaagaatgaattgaga
cttcgtccatttaaaacatctaacagaattttggacgatcttaagtacaccccagcgctt
ttcaagatgcttagtcaaggcagattgcaaaaaccgatcacatctttcctcaattcgtct
ccctttgcgtacaaggacatcttgccacatatcttacaattagaacgctatgaaacgttg
attctaaataatgccgttgattacattcccctggtggaaaagcatgaattgaaggattgt
aatgtaactgtctccacagttagaggtttgattgtcagctctctgaatgacgagatcaac
cattttaaaatcgtcattcttgagaagctgccgccgttgtcgcgtattccaattgacaag
catgagtatcatcagatcgaaaagagcatgttatctgcggatgacctaaacattatgaat
gacaaatcaaatgcttcttcaaatttaattgatgatgcatttttcaaaagtggcaacagt
cttgtaaaccacattatgagagtgtctgtctacactctggagttcacgaaagaggatcta
ctctctagcatagattcaaatcttatcaaagagcgatacttgcgtggcatagagagcagt
cccgattcccagttgagcattgattccattcctggccctgtccattgtttgcaaacatta
ttgaaagtattgaaaggacccataaatcttcccgcaacagaaccaattcacacaattagc
aagtcgaagactctattggatgtgaaaattgaccttcgtctcttattcgaaaaattttct
ttcactttgggagacgatgaagatagtctcatccctcctaacctttcgctcaatccgtct
ctcaaggaagcatacattcggaaagcctatgaattggtatttattggaaaatccctcaag
acaagtaaggtaaatgattttgatacaaaatattcattcagtgataacatggctcaagta
cactcaattttgtcagagatagacaaacactctgcattggcgaacagcagaagccgtgaa
acaaacaggtattccttctttattgctttaagttgctgtgtcttctatcaggacgagttg
attattcgctgttacgaaaataccgttgtttcagacccaagaaataagatggcatacgtc
gattgcttcaagaagataatggaaaatcgatcatcaggctcgacgggcagattggcttcc
tatcacaacagtcaatacctaaagggtcttatgtatggatattctgattatgaagctgct
ctcaagattctcgggattgaattaataccatcggatgacgatgtggaaattgatgcgatc
attgagatgtacaaagcagccactaattcagatccaaaaaattatgcatacttcaacaat
caagtggagaagatcgcaaagattcgtgatagccttgaattgaaggactttttagcgaat
gaaattatacccatgagcattgctttgaatgaattgagaatcgaagaagtaaccgaagat
gaagttgttattacagcgtttgaattcagacttaatgatgtcatgcaagaagtgaacttc
aattcaaacagtcctgaaattagaatccttcaaaggagtttatactctgttgcattaaac
agaaagagttatatcttgttgaattacattgaaaaaaagttccctgatttacagcagaag
atgaatattacgttttctgacgctctcagaattttggaggtgacggccgactctactgat
ttcgaaataattaccaattttcaagagaagcttgctaagtcctctttgcacgatccggta
gacgttcgtgccctaagagcatccctcaaaagggtggcagaagagcgtaaatcaaatata
ttgatgagtttcttggagcaaggaaaaattgatccatctttgcaaccacctgagctttgg
cccactggtcttgataatattgggaatacgtgttatctcaactctttgcttcaatattat
ttttgcattaagccgttgagggacatgattcttaactttgacgaagcaaacgtcaagatt
gatccaaacagtgctcgaaaaatcggaggtcgtaaagtggaagagtccgaattgaatcgt
tcttttcaatttatttaccgtcttcaaaagttgttcaatgaaatgatttcgagtaaggag
cgttgcgtgcaacccagcaaagaattggcatatcttgcatttttgcctctttcccagcct
attgattttaaagacaatagtgaattacctttgcctggtggagatgatggtgtcattgat
actgaatttgagccaattatagtggattctgaatctccagaattaatgtcagcagacact
gacatggacaaagacaatcaagatttgatcgtattagatagtacatgcacttctcccaat
ctcgaaagtgcaccatctttgaatatggttgaggtcgatagtatgcatgtggaggacaat
caagtggatattgcgacaggaaaaaaaatattggcgattagttcagaccaaattgaaagt
acaatcgaattgggcagacaacaagatgtcacagaatgtattgaaaatgtcacatatcag
attgaaacagcacttgaaccagaaaaaattgagtctgacggtgaacagtttgacctcatc
aagaaacttttctgtggcaagaccaaacaaactattactcccttgggtgaagaaaaagcc
aatgttagggtatcagtcgaaaggttcttcagtttgatcatcaacgttggagaccatcca
aaggatatctacgatgcattagataactactttaacgaggattcagttgaacttgaagaa
ggcgaagttaaaaaagccctaactattcaagagctaccacaagtgcttcagttccacgtc
caacgtgttttgtttgatcgagaacgtttggtcgcttataaatctttggaagttatcccc
tttggagagactatctatgttgatagatatctcgagacggatgacgaggaaatcatagcg
aagcgtcaagaggtctttgattggaaatcagaaatgaaaaagttatatgccgagaaagat
tctattctcatggttgattcagagacaaaactttcagcgcttgatgctttaaaggcaaca
ttgaagtatttggagacaaatactctaaaactggagttgaactgtgtgaagcagagtact
attgactcaattaggagccaaattcatcttcttgagttgaaacttcaggccattgagaac
aagttgatctctttacaagataaagtatcaactcaatttgattcatacaagcaggtaggt
tattcactatttgcgattttcatccatcgaggtgaagcttcttacggccattattggatt
tacatcaaggatcctcataggaatatttacaggaagtacaatgatgaaacggtgacagag
gttccatattctgaggtctttaactttacaacaactaacacagctacgccatattatatg
gtgtatgtgaagtcggaactaatggatgaatatattgagccattgaagagggaaatcaaa
tgttga

DBGET integrated database retrieval system