KEGG   Clavispora lusitaniae: CLUG_03653Help
Entry
CLUG_03653        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
clu  Clavispora lusitaniae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLUG_03653
Enzymes [BR:clu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CLUG_03653
Glycosyltransferases [BR:clu01003]
 Polysaccharide
  Storage polysaccharide
   CLUG_03653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 696 aa AA seqDB search
MTRDIQNHLLFEVATEVAHKVGGIYSVLKSKAPITVSEYKERYTLIGPLHHESAQIEVEE
IPLNDPHVKAALDAMSERGIKWLYGRWLIEGAPRVLLFDIHSADYMLNEWKADLWNIAGI
PTPDHDHESNEAILLGYIVAWFLGELVYVDRERAVICHCHEWLAGVALPLCRKRRIDVTT
IFTTHATLLGRYLCAGSTDFYNNLKYFDVDAEAGKRGIYHRYCIERSATHSADVFTTVSH
ITAYESEHLLKRKPDGVLPNGLNVVKFSAVHEFQNLHALSKDKINEFVRGHFYGNYDFEL
DNTLYFFIAGRYEFRNKGADFFIESLARLNHRLKQSNSKMTVVAFIIMPGKINSYTVETL
KGQAVLKQLENSISEVQKKIGERLFEHCARFPNKSNVHNTNGSEVPSIDDLIKPADRVLL
KRRIFALKRDGLPPIVTHNMTNDATDPVLTHIRRVQLFNKPEDRVKIIFHPEFLNSNNPI
LPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEDLIENTSDY
GIYIVDRREKSVDESINQLVDYMFDFTQKTRRQRINQRNRTERLSDLLDWKRMGLEYIKA
RQLSLKRAYPDRFKNGANPFQNSSNLKLTRPLSVPGSPRGRVGLMTPGDLGSLQEAAQGL
NTEDYQGFKLGEADDDDEESHYPLTLRGTSAPPQDA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgaccagagacattcagaaccatctccttttcgaggtggccacagaagtcgcccacaaa
gttggtggcatttactctgttctcaagtccaaagcccccatcaccgtttccgaatacaag
gagcgctacaccttaattggtccattgcaccatgaaagtgcccagattgaggtggaggaa
atccccttgaacgacccacacgttaaagcagctttagatgccatgagcgaacgtggtatc
aagtggttgtacggaagatggttgattgaaggtgccccccgtgttttgcttttcgatatt
cattctgctgactacatgctcaatgaatggaaagctgacttgtggaacattgctggcatt
ccaactcctgatcatgaccatgaatccaacgaagctattctcttgggttacattgtggcc
tggttcttgggcgagttggtctacgttgatcgcgagcgtgcagtgatttgccattgtcac
gagtggttggctggtgtggccttgccgctttgcagaaaacggagaattgatgtcacaacc
atcttcaccacccacgcaacattgcttgggcggtacttgtgtgcgggatctactgacttt
tacaataatttgaagtactttgacgtggacgccgaagcaggcaagagaggaatttatcac
cgctactgtattgagaggtctgcgacccactctgcagatgtgtttactacagtgtctcat
ataactgcttacgagtcagagcatttgttgaagagaaaaccggacggtgttttgcctaat
ggtttgaatgttgtcaagttttctgccgtgcatgagttccaaaacttgcatgcgcttctg
aaggacaaaatcaacgagtttgtgagaggccacttctatggaaactacgacttcgaatta
gacaacactctctatttcttcattgcaggcagatatgaatttagaaacaagggtgcagat
ttctttatcgaatccttagcaaggttgaaccacagattgaagcaatctaactcgaaaatg
acggtcgttgcatttataatcatgccaggaaaaatcaattcttacaccgtggaaacattg
aaaggccaagcggtgttgaaacagttggaaaactcgatttctgaggtgcaaaagaagatt
ggtgaacgtttgtttgagcattgcgcacgattcccaaacaaaagcaatgtccataacacc
aatggtagcgaggtcccatctattgatgacttgatcaaaccagctgaccgtgttttgttg
aagagaagaattttcgctttgaaaagagatgggttgcctccgattgttactcacaatatg
accaacgatgccaccgatccggttttgactcacattagacgcgtacagttgtttaacaag
ccggaggatagagtcaagattatattccatccagagtttctcaattctaacaatcctatt
ttgcctttagattacgaggaatttgtgagaggatgccatttgggtgtctttccatcgtac
tatgaaccatggggttataccccagctgaatgtacagtgatgggcgtaccttcgattaca
actaacttatctggctttggttgttacatggaggatttaatcgaaaacaccagtgactat
ggaatttacatcgttgatagaagagaaaaatctgttgatgaatcaatcaatcagttagtt
gattatatgtttgattttacccaaaagacgagaagacaaagaattaaccagagaaataga
acagaaaggttatctgatttgttggattggaagagaatgggccttgaatacattaaggct
aggcaattgtcgttgaagagagcttatccagatagatttaagaatggagcaaatcctttc
caaaactctctgaacttgaaattgacaagaccattgtctgttcccggatctccaagagga
agagttggtttgatgactcctggtgacttgggatctttacaagaggctgcccaaggattg
aataccgaagattaccaaggtttcaaactaggcgaggccgatgatgatgatgaagaaagt
cattatccgttgaccttacgtggtacttctgctcctcctcaagacgcataa

DBGET integrated database retrieval system