KEGG   Clavispora lusitaniae ATCC 42720: CLUG_03660Help
Entry
CLUG_03660        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLUG_03660
   00640 Propanoate metabolism
    CLUG_03660
  Lipid metabolism
   00061 Fatty acid biosynthesis
    CLUG_03660
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CLUG_03660
Enzymes [BR:clu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     CLUG_03660
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CLUG_03660
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CLUG_03660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 2296 aa AA seqDB search
MRASGTILTCQNTNSSRFPRLSGPFKHFVHTRTPHITLLRAHRCLSIQQNNHAPKSRAKF
IGQLGNLFNQAYNSIQKLAMPQSFPDCSELHSGLPPHFIGLNTVQDAEPGAVTDFVKSHQ
GHTVISKVLIANNGIAAVKEIRSVRKWAYETFGDERAIQFTVMATPEDMAANAEYIRMAD
QCVEVPGGTNNNNYANVELIVEIAERTKVHAVWAGWGHASENPLLPEMLAASPRRIIFIG
PPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVQVDEATNLVSVSDEVYAKGCCTS
PEDGLEKARIIGFPVMIKASEGGGGKGIRKVDDEKDFISLYKQAANEIPGSPIFIMKLAG
DARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIANKDTFHAMENAAVRLGK
LVGYVSAGTVEYLYSHAEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHR
IRDIRTLYGVDPHTSTEIDFEFKNEKSLSTQRRPTPKGHCTACRITSEDPGEGFKPSGGN
LHELNFRSSSNVWGYFSVSNQSSIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRG
DFRTTVEYLIKLLETPDFEDNTITTGWLDELISKKLTAERPDPILAVLCGAATKAYIASQ
EDRAEYVSSLERGQVPNKSLLRTIFPIEFIYEGHKYKFTATMSADDTYTLFLNGTRAVVS
VRSLSDGGLLCAIGGKSHSIYWKEEPSATRLSVDGKTCLLEAENDPTQLRTPSPGKLVKY
VVESGEHVIAGQPYAEVEVMKMCMPLIAQENGVVQTIKQPGSTVNAGDILAILALDDPSK
VKHALPFEGTLPEMGEPSVQGSKPVHKFQQYATILRNILAGFDNQVIMNSTLKNIIEVLR
DRELPYSEWNLYASALHSRLPAKLDESLSTLIERSHSRGTEFPAKQILKLISKAEKESGD
SLFGSIVAPLVDIASKYASGLVEHEFNFMASLLNDYYNVEKLFSGSNVREEDVVLRLRDE
NKTDLNKVLSIVLSHSRVSSKNNLVLAIAEAYQPILQQSATIASSIRDALRNIVELESRG
SAKVALKAREILIQCSLPSIKERSDQLEHILRSAVLQTSYGEVYAKYRSPNFDIIREVVD
SKHTVFDVLLQFLTNQDVWVAMAAAEVYVRRSYRAYSLGPITYDFQEQEKLPIIQWQFQL
PSLATSSNFQNFKKEESTSMNRAASISDLSFVVDSKTGQKTRTGILVPVRHIDDMDEMLL
AGLEKINPSDAITFKTGTTEPEYFNVVNVVVSSIDGIESEDEVLQKIQETLDDNKDELKN
AGVRRITFVFANNVGTYPKYYTFTAPDYLENKVIRHIEPALAFQLELGRLENFDIKPIFT
DNRNIHVYEAVGKNSPSDKRFFTRGIIRTGVINEDISISEYLISESNRLMSDILDALEVI
DTSNSDLNHIFINFSAVFNVLPQEVEAAFGSFLERFGRRLWRLRVTGAEIRISCIDSATG
QPFPLRAIISNVSGYVVKSELYMEIKNTKGDWVFKSIGAPGSMHLRPISTPYPAKESLQP
KRYKAHNMGTTYVYDFPELFRQATISQWKKHSKDAKVPKDFFSSSELIQDENGGLTAVER
EPGSNKIGMVGFQVTAKTPEYPRGRQFIIVANDITHKIGSFGPDEDEYFNRCTELARKLG
VPRIYLSANSGARIGIAEELLPYYKVAWNEDGKPEKGFKYLYLTADALHALDENGQGKSV
VTERIVENGEERHVIKSIIGAENGLGVECLKGSGLIAGATSRAYKDIFTITLVTCRSVGI
GAYLVRLGQRAIQIEGQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYKNGVSHLTASD
DLAGVEKIMDWMSYIPAKRGAPIPILNSEDPWNRDIDYVPPKSEPYDVRWMIAGREQEDG
SFESGLFDKDSFQETLSGWARGVVVGRARLGGIPIGVIGVETRTVENLIPADPANPDSTE
MMLQEAGQVWYPNSAFKTAQAINDFNNGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFI
VDALVDFKQPIFTYIPPHGELRGGSWVVVDPTINADMMEMYADVDSRAGVLEPEGMVGIK
YRRDKLLATMERLDPTYAELKKKLAGKLDADEYSQVSAKLVAREKALLPIYAQISVQYAD
LHDRSGRMMAKGVIRKEIEWRHARRFFFWRLRRRLNEEYLLKMIGEAINSKSKLEKVARL
KSWMPTVDYEDDEAVCNHIESNHTKLQERIDELKSEKKRQDLYGLLKGDSSSAVSVIKDF
ISSLPEEEKQKFVQSL
NT seq 6891 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcatccggcaccatattgacctgtcaaaatactaactcttccagatttcctcga
ctactgggccccttcaagcactttgtacatactagaaccccgcatattacattattgcgt
gcacatcgctgtttgagcatccaacagaacaatcacgcccctaaatctcgagccaaattc
ataggtcaactcgggaatctctttaatcaagcctataattctattcagaaactcgccatg
cctcagtcatttcctgattgcagcgagctccattcgggcttacctcctcattttataggg
ttgaatactgtccaggacgcagagcctggtgcagttactgactttgttaagagtcaccaa
ggtcacacagtcatttccaaagttttgattgccaataacggtattgccgctgtcaaggaa
atcagatccgtcagaaaatgggcttacgagacctttggcgacgaaagagccatccaattt
accgtgatggccaccccagaagacatggctgcaaacgcggaatacatccgtatggctgac
cagtgtgtcgaagttccaggtggtactaacaacaacaactacgctaatgttgaattgatt
gttgaaatcgcagaaagaacaaaggtccacgctgtctgggccggttggggtcatgcctca
gaaaatccattattgcctgaaatgttggctgcttccccaagaagaatcatctttattggt
cctcctggttctgccatgagatctttgggtgacaagatttcctccacgattgtcgctcaa
cacgctaaagttccatgtattccatggtctggtactggtgtggatgaggtgcaagtggat
gaagctaccaacttggtttccgtttccgacgaggtttatgccaagggctgttgtaccagt
cctgaggacggcttggaaaaagcgagaataatcggctttcctgtcatgatcaaggcttct
gaaggtggtggtggtaaaggtattagaaaagtcgacgatgagaaggacttcatctccttg
tataaacaagccgctaatgaaattcctggatcgccaatttttattatgaagttggctggt
gacgccagacacttggaagtgcaattgttggctgatcagtatggtacgaatatttctttg
tttggcagagactgttcggttcaaagaagacaccagaagatcattgaagaagcccctgtt
accatcgctaataaggacactttccatgccatggagaatgctgctgttagattaggtaaa
ttggttggatacgtctcagcaggtactgttgaatacttgtactctcacgctgaagataaa
ttctactttttggaattgaacccaagattgcaggttgagcatccaacaacagaaatggtt
actggtgtcaacttgcccgcagcccagttgcagattgccatgggtattcctatgcacagg
attagagacattcgtaccttgtacggtgttgacccacacacctccactgagattgatttt
gagttcaagaacgaaaagtccttatcgactcaacgccgtccaacaccaaagggccactgc
actgcttgtcgtatcacttctgaagatcctggtgaaggtttcaaaccttctggtggtaac
ttgcacgaattgaacttccggtcgtcgtctaacgtctggggttacttctctgtgagtaat
caatcttcgatccattctttctcggactcgcaattcggccacatttttgccttcggtgaa
aatcgtcaagcttccagaaagcacatggttgttgcattgaaagagttatccattagaggt
gacttcagaactacagtcgagtatttgatcaagttattggagaccccagatttcgaagac
aacacaatcactacgggctggttggacgagttgatttccaaaaaattgaccgctgagaga
cctgaccccatcctcgctgtcttgtgtggtgctgccaccaaagcgtacatcgcttcccaa
gaagacagggccgagtatgtttcgtctttggaaagaggtcaagttccaaacaaatctttg
ctaagaaccattttccctattgagttcatttatgagggccacaaatacaagtttactgct
accatgtctgctgatgatacctacactttgttcttgaatggtacaagagcagttgtgagc
gttcgttctttgtctgacggcggtttattgtgtgcaattggtggtaagtcgcactctatt
tactggaaggaagagccatctgctaccagattgtctgttgatggtaagacttgtttgttg
gaggcagaaaacgacccaactcaattgagaactccttctccaggtaaattggtgaagtac
gttgttgagagtggtgaacacgttatcgctggtcaaccatacgccgaggtggaagtcatg
aagatgtgtatgcctttgattgctcaggagaatggtgttgtgcaaacaatcaaacaacca
ggatcaacagtcaatgcaggtgatatcttggctattttggccttggatgacccatcgaag
gtgaaacacgctttaccctttgaaggtactcttccagaaatgggagagccttctgtccaa
ggttctaagccagttcacaagttccagcagtatgctaccattttgagaaacatcttggct
ggatttgataaccaagttatcatgaattctaccttgaagaacattattgaggttttgaga
gaccgtgaattgccttactctgagtggaacttgtacgcgtctgctttgcactctagattg
ccagctaagttggatgagagcttatccacgttgattgaaagatctcattcgagaggtaca
gaattccctgccaagcaaattttgaaattgatcagcaaagctgagaaagaatctggcgat
tctttgtttggtagtatcgttgctccgttggttgatattgcctctaaatacgctagtggt
ttggttgaacacgaattcaacttcatggcaagcttactcaatgactactacaatgtggag
aagttgttttctggttccaacgttcgtgaggaagatgtcgtcttgagactcagagatgag
aacaagacagacttgaacaaggttttgctgattgttttgtctcactcgagagtttcctct
aagaacaacttggtcttagctattgctgaagcttaccaaccaatcttgcaacaatctgct
accattgcatcttccatcagagatgcattgagaaacattgtcgagcttgagtctagagga
tcggccaaggttgctttgaaggctagagaaattttgattcaatgttctttgccatcgatc
aaagaaagatcagaccaattagagcacatcttaagatctgccgtgttgcaaacgtcgtac
ggtgaagtgtacgcaaagtacagaagtccaaactttgacatcattcgtgaagtcgtcgac
tccaaacacactgtatttgacgttttgcttcaatttttgacaaatcaggatgtatgggtt
gcaatggcagcagctgaggtttatgttcgtcgttcttacagagcctattctttgggtcct
atcacttacgatttccaagaacaagagaaattgccaattattcaatggcagttccaatta
ccatctctcgctacttcttctaatttccaaaactttaaaaaggaagaatcaacatctatg
aatcgagcagcttctatttctgacttgtcattcgttgtggacagtaagactggccaaaag
accagaaccggtattttggtcccagttagacacattgatgacatggatgaaatgttactt
gctggtctcgaaaagattaacccatctgatgctatcactttcaagactggtactaccgaa
ccagaatatttcaatgtggtgaatgttgttgtcagcagcatcgacggtatcgagtcagaa
gacgaagttttgcagaaaatccaggaaacacttgacgacaacaaggacgaattaaagaac
gctggtgttcgtcgtattacctttgtttttgcgaacaatgttggaacgtaccctaagtac
tacacattcactgctccagattaccttgagaataaggttatcagacacattgagcccgcc
ttagctttccaattggagttgggaagattggagaactttgacatcaagccaattttcacc
gacaacagaaacatccatgtttacgaggctgtcgggaagaactctccatcagacaagaga
ttcttcactagaggtattattagaactggtgttatcaacgaagacattagtattagtgaa
tacttgatctccgaatcgaaccgtttgatgtctgacattttggatgcattggaagtcatc
gacacgtctaactcagacttgaaccacatcttcatcaacttttctgctgttttcaatgtc
ttgcctcaagaagttgaagctgctttcggatctttcttggaaagatttggcagaagattg
tggagattgagagtgactggcgctgaaattcgtatatcttgcattgattctgccactggt
caacctttcccattgcgtgctatcattagtaacgtttctggttatgtcgtgaagtctgag
ttgtatatggagattaagaacactaagggtgactgggtgttcaaatccattggtgctcca
ggttctatgcacttgagaccaatttctactccctaccccgcaaaagagtcattgcaacct
aaacgttataaagcgcacaacatgggaaccacctatgtgtatgacttccctgaattgttc
cgccaggccactatcagtcaatggaaaaaacattctaaggatgccaaggtgccaaaggac
tttttctcttcttctgagttgatccaagatgaaaacggaggcttgaccgcagtcgagaga
gaaccggggtcgaataagattggtatggttggtttccaagtcactgctaaaactcccgaa
taccctcgtggtcgccagtttatcatcgttgccaatgatattacgcataagatcggttcg
ttcggtcctgatgaagatgagtacttcaacagatgtaccgaattggcaagaaaattggga
gttccaagaatttatctttctgccaattctggtgctagaattggtattgctgaggaattg
cttccttactacaaggttgcttggaatgaggatggcaaaccagaaaagggtttcaaatac
ttgtacttgaccgctgatgcattacatgctcttgatgagaatggacaaggtaaaagtgtg
gttaccgaaagaattgttgaaaatggtgaggaaagacatgtgatcaaatccattatcggc
gctgagaatggtttgggtgttgaatgtcttaagggttccggtttgatcgccggtgctact
tcaagagcctataaagacatcttcaccatcactttggtaacttgcagatctgttggtatt
ggtgcttacttggttcggttgggccaaagagccattcaaattgaaggacagcctatcatc
ttaactggtgcgcccgctattaacaaattgttgggcagagaagtgtactcttccaacttg
caattgggtggtactcaaattatgtacaagaacggtgtgtcccacttgacagctagcgat
gatttggctggtgttgagaaaattatggattggatgtcgtacatcccagctaagcgtggt
gctccaattccaatcttgaacagcgaagacccatggaatagagatattgactatgttcct
ccaaagagtgagccttatgatgtgagatggatgattgctggtcgtgaacaagaagatgga
agcttcgaatctggtttgttcgacaaggactctttccaagaaaccttgtctggatgggca
agaggtgttgttgttggtagagcccgtctcggtggtattccaatcggtgtgattggagtt
gaaacaagaaccgtcgaaaacttgattcctgctgacccagcaaacccagactcgaccgaa
atgatgcttcaagaagctggccaggtttggtaccctaactctgcattcaagactgctcaa
gctatcaacgacttcaacaatggtgaacagttgccattgatgatcttggctaattggaga
ggtttctctggtggccagcgtgacatgtacaatgaagttcttaagtacggttctttcatt
gttgacgctttggttgacttcaaacaaccaattttcacttacattcctccacatggtgaa
ttgagaggtggttcttgggtcgttgtcgatccaacaatcaatgctgacatgatggaaatg
tatgctgatgtggactctagagccggtgtcttggagccagagggaatggttggtatcaaa
tacagaagagacaagttgttggctaccatggagagattggacccaacatacgcggagttg
aagaagaagttggctggtaagttggacgctgacgaatactcacaagttagtgccaagttg
gttgctcgtgagaaggctttgttgccaatttacgctcaaatctctgtccagtatgctgac
ttgcacgacagatcaggccgtatgatggccaagggtgtcattagaaaggagattgaatgg
cgccatgctagacgcttcttcttctggcgtttgcgtcgtcggttgaacgaagagtacttg
ttgaagatgattggcgaagcaatcaacagcaagtctaagttggagaaggttgcaagattg
aagagttggatgcctactgttgactatgaagacgacgaggctgtgtgcaaccatattgaa
agcaatcatactaagttgcaagaaagaatcgatgaattgaagagtgaaaagaaacgccaa
gacttatacggtcttttgaagggcgactcgtcttctgcagtgtctgtgatcaaggatttc
atctcatccttacctgaagaagaaaagcaaaaatttgttcaatctttgtaa

DBGET integrated database retrieval system