KEGG   Clavispora lusitaniae: CLUG_03729Help
Entry
CLUG_03729        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
clu  Clavispora lusitaniae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:clu00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CLUG_03729
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CLUG_03729
Protein kinases [BR:clu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CLUG_03729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 580 aa AA seqDB search
MGEERDVSDTTSRFDRLGISSPRSGSLEGTHSPPISTAHGQLSSDIQARIMAFQQKRQNI
PLKEPPSKPLPPLPNAPIRSSSAVESVKQPLLASPSMEASTPTSQGSPQNVTPTSTQQQG
LSKKPSLSQRRGMKLNMNDLSGQNSDAAPSTGVELARRLSERKRPDMKLNLNDQGSGISS
APVTAAEKAQGKSIDDEPKLQGLFANYSKYVDIKSGSLNFAGKASLHSEGVNFSSGSSFH
ISLDELQFIEELGRGNYGTVSKVLHKPTGVLMAMKEVRLELEENKFTQILMELEVLHKCN
SPYIVDFYGAFFVEGAVYMCMEYMDGGSLDKVYGDGVHDEACLAYITECVIRGLKELKDK
HNIIHRDVKPTNILVNTMGKVKLCDFGVSGNLVASLAKTNIGCQSYMAPERIKTLNPDDA
TYSVQSDIWSLGLTILEIAAGCYPYPPETYDNIFSQLSAIVDGEPPKLDDSIFSKEAQMF
VKSCLNKNPALRPHYDVLLKSPWLTRYRDIDPHMGDFVKEGLKRAKEETGEARSTKPATG
NVAVAGAAFSGRENVQSLLKNKVAAPALHRGGLHNQRLRR
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagaaagagatgtttctgataccacctcccgatttgatcggctaggaattagt
tctccccgcctgggatcgctagaggggacccattcaccacctatatctactgcccatggc
cagttgagcagtgatattcaagcccgcataatggcctttcaacagaaacgtcaaaacatt
cctctaaaagaaccgccaagcaagcctcttccacctcttcccaatgcacctataagatca
tcatcggcagttgaatccgtgaagcagcctttgctagcatctcctctgatggaagcactg
accccaacttctcaaggctctcctcaaaatgttactcctacttccactcagcaacagggt
ttgtcaaaaaaaccatccttgtcacaaagacggggaatgaaacttaacatgaatgatttg
ctgggccaaaattcagatgcagcaccttccactggcgtagagcttgcccgtcgactctcg
gagagaaagcgcccagacatgaaattgaatttaaatgaccaaggcagtggcatctctagt
gcgccagttacagctgctgaaaaggcacaagggaaatctatcgatgacgaacctaagttg
caaggactttttgcgaattactccaaatacgtggatattaagtcagggtcgcttaatttc
gccggaaaagcatcattgcattctgaaggcgttaatttttcttccggttcatccttccac
atctctttagatgaattacaatttattgaggagttgggccgtggaaattacggaacagtg
tcaaaagttttgcataaacctacaggagttttaatggcaatgaaagaagtcagacttgag
cttgaggaaaacaaatttactcaaatcttaatggaattggaggttttgcacaagtgtaat
tcgccatatatcgttgacttttatggcgctttctttgtcgaaggtgctgtttacatgtgc
atggaatacatggatggcgggtctcttgacaaagtctatggcgatggcgttcatgacgaa
gcatgtctcgcttatatcactgaatgtgtcatcaggggcttgaaggagttgaaggacaaa
cataatattattcatagagatgtgaagccaaccaatattttagtgaacaccatgggaaaa
gtcaagttgtgtgattttggtgtcagcgggaatttggttgcttcgttggcgaaaactaat
attgggtgccagtcctacatggcccctgaacgaatcaagactttgaaccctgacgatgca
acatattcagtgcagtccgacatttggtccttgggattaacaattttggagatcgcagca
ggttgttatccctatccgcctgaaacatatgacaatatttttctgcaacttagtgccatt
gtggatggtgagccaccgaaattagatgattctattttttccaaagaagcccaaatgttt
gtcaaatcctgtttaaacaagaaccccgcattacgtcctcattatgatgtgcttttgaaa
tcaccgtggttaacacggtacagagatatcgacccgcacatgggtgactttgtcaaagaa
gggttgaagagggccaaagaagaaacaggcgaagccagatcaaccaaaccagcaacaggt
aatgttgccgttgctggtgccgcgttctctggaagagaaaatgtgcaaagcttactcaag
aataaggtggctgcacctgctttacacaggggtggtttgcacaaccagagattgcgccgg
tag

DBGET integrated database retrieval system