KEGG   Clavispora lusitaniae: CLUG_03851Help
Entry
CLUG_03851        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
clu  Clavispora lusitaniae
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:clu00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 471 aa AA seqDB search
MSRDQMSTEQLLPSAAVANERGFHIRNPTSGCLSFLHDSTTHIPFRDILWSTGDGATRHI
TYAARRGHKIQIESTDVIVPEGMDVMALAYPHSKPAPNILVVVNNFGGQGRAGERYRQHI
LPVLRAARATVTYMETQYARHAVDIGRELDIARYDMVVCCSGDGVPHEIINGFWEREDRA
TAFDKVAVTQLPCGSGNALSLSTHGSNDATKAALSMLKARRSKIDVMSVTQGTRTRLSFL
SQAYGVIADSDIGTEHLRWMGPVRFELGVAQRLISKKKYPCELYVKYAARGSEVARHFER
VRKSNGEEESSEAEQYAVDSSRNGDSVPEPQAPPLSDPVPEDWEKVPAANLSIFYVGKMP
YMSSDAQFFPAALPRDGLMDLVITTTDSSFLKMARLLMAVDSGAHVHAPEVHHAKIAAYR
LIPLVDPNKNYISVDGESFPVEPMQVEVLPSLLTVLLHEGEYVDTNFAEQK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtgaccaaatgtcgacagaacagctcttaccatcggctgcagtggcaaacgaa
cgaggatttcatattcgcaacccgacaagcggatgtctcagttttcttcatgactctacc
acacatataccctttcgcgatatcttgtggagcacaggtgacggagctacacggcatatc
acgtatgcagctagacgtggacacaaaatccagattgaatccaccgacgtgatagtccct
gaaggaatggacgtgatggcactcgcatatccacatagtaagccagcgcctaatatcctt
gtggttgtgaataactttgggggccagggccgtgctggggagcggtatcggcaacacatt
ttacctgtattgcgtgcagcacgagccaccgtcacatacatggagacgcagtatgcgcgc
cacgcagtggacattgggcgcgagctagacattgcgcgctatgacatggttgtatgctgc
ctgggtgacggcgtgcctcacgaaatcataaacggtttttgggagcgcgaggaccgtgcc
actgcctttgacaaggtggccgtgacgcagcttccgtgcggatcgggcaatgcgcttctg
ttgagcacacacggcagtaacgatgcgacgaaggcagccctcagtatgctcaaggcgcgt
cggagcaaaattgatgtcatgtctgtgacccaaggcacacgcacacgcttgtcatttttg
tctcaggcatatggtgtgatagccgatctggacatcggaaccgagcacttgcggtggatg
gggcctgttcgcttcgaacttggtgtggctcagcgcttgatcagtaagaaaaagtacccg
tgtgaattgtatgtcaagtacgctgcccgtggctcagaagtggcgcgccattttgaacgg
gttcgcaaatccaatggagaagaggaaagcagcgaagcggaacagtatgccgtggattcg
agcaggaatggtgactctgtgcccgaaccgcaagcccctcctctctcagatcccgtacct
gaagattgggaaaaagtccccgctgcaaacttgagcatattttacgtgggaaaaatgcct
tacatgctgagcgatgcacaattcttccctgcagctttaccccgtgatggactaatggac
ttggtcattaccacaactgactcgctgttcttgaaaatggcccgtttgctcatggctgta
gactcgggtgctcacgtgcatgccccagaggttcaccatgccaagattgctgcataccgc
ttaattccgcttgtggaccccaataagaattatatttctgtggatggtgaaagtttccct
gtggagcccatgcaagtggaagtgttaccatcgcttttgactgtgttattgcatgaagga
gaatacgtggatacaaattttgctgagcaaaagtag

DBGET integrated database retrieval system