KEGG   Clavispora lusitaniae: CLUG_03853Help
Entry
CLUG_03853        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
clu  Clavispora lusitaniae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLUG_03853
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CLUG_03853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 533 aa AA seqDB search
MSLVPKNGKVAVIGAGISGLSYSYFLSKLRPDLHISIFESGAQPGGWIKTEALYDNGHKV
LLEKGPRTLRGVSDGTLLIVDMMKQLGLQNEVEVMKSSSLANRKWLLDPTNKLVQVPNSF
PSFVKFISSGIPSGLARGILGEPFRKKTTSDKDESVRSFIERRFGSPALADNVLSAIMHG
IYSGDVSRLSAKATLPSLLEYEREYGSIIKAIWSKMTGKNKKEKEGINEALLEYERDISP
GADLSNLSKSLKQYPILRLHSGLQVLPLALANYLIQQKNVDIFYNTQIDKLKIDSCEIDV
QGSRTVFDYVRYTADAKGFGKITDVTDADAKTAIESFEYTTIFLANVYSKTVRLVPPKHE
GFGFLVPKRNTNHQALLGVIYDSDTERDAQKFFGGKSIENLPYHKITLMMGGHYYNSGRI
PSSGINVKIVKEILCDILEVDLEKHNVVVRNEADLHSKDIALGDNDILISYNLHENCIPQ
YNVGFLDSVNTMLKYVQRVSGGKVSIGGTSLGKLGVPDCVMNSLDDAMLLRLD
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttgtaccgaaaaatggcaaagtagcggtaattggtgccggcatttccggatta
tcatacagctactttcttctgaaattacggcctgacttgcacatatccatctttgaatct
ggagcacaacccggaggatggatcaagactgaagctctttatgacaacggccacaaagtg
ttacttgagaagggacccaggacacttcgaggggtcagtgatggtaccttgctcatagtt
gatatgatgaaacaattgggtttgcaaaacgaagtcgaagttatgaaatcttcttcctta
gccaaccggaaatggcttcttgatcctacgaacaagcttgttcaagtaccaaactccttt
cctctgttcgtgaaattcatttcaagtggtattcctctgggtttagctcgcggtatttta
ggtgaaccgttccgcaagaagacaacctctgataaagatgaatctgtccggtcgttcatc
gaaagacgctttggctctccagctctagccgataatgttctcagcgcaataatgcatggc
atttatagcggagatgtttcaagattgagtgccaaagcaacactaccatcgttattggag
tacgaacgagaatatgggtctataataaaggcaatctggctgaagatgactgggaaaaat
aaaaaagaaaaagagggaataaatgaagcacttttggagtatgagagggacatttctccc
ggagctgacctctctaacttgtcgaaatctctaaaacaataccctattttgagactccac
agtggtttgcaggttttgcctttagcattagcaaactacttgatacaacagaagaatgtt
gatattttctacaacactcagatagataagttgaagatcgacagctgtgaaattgatgtt
caaggctctagaaccgtttttgattatgtgcggtatacggccgatgcaaagggttttgga
aaaatcaccgacgtcaccgatgcagatgcaaagacagcaatcgagctgttcgagtataca
acaatattcctagccaatgtatacagcaaaactgtcaggctagtaccaccaaagcatgag
ggcttcgggtttctcgtcccaaaacgaaataccaatcaccaagcgctcttgggcgtgata
tacgactctgatacagaaagggatgcccaaaagttttttggagggaaaagtatagagaac
ttaccttaccataagattacgttgatgatgggaggacattactataattccggaagaatc
ccttcgagtggaattaatgtgaagattgtaaaagagatactttgtgacattttagaagta
gatctcgaaaagcacaacgtcgttgtgagaaatgaggctgatcttcactctaaggacatt
gcacttggtgacaacgatattctaatttcttataatctccacgaaaactgcatcccacaa
tataacgtgggatttttagacagtgttaacacaatgttgaaatatgttcaacgagtatct
ggtggaaaagttagcatcggaggcacaagtctcggcaaattgggggtgcctgactgtgtg
atgaacagtttagatgatgctatgcttcttagattagattaa

DBGET integrated database retrieval system