KEGG   Clavispora lusitaniae: CLUG_03935Help
Entry
CLUG_03935        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
clu  Clavispora lusitaniae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CLUG_03935
Enzymes [BR:clu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CLUG_03935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 469 aa AA seqDB search
MKDTYSFLNGKSKLQDTQNHVLHLPSFTKKHGSDTSDRKRKRNLFPMQHALNYDDRESDD
SDEEDSSRSATPVPATKREADRFNDEENVSYKRSKLRESFLYNEYSDEEMSEDGQEEPEE
GKVAEDNVAEPKSELDMMYEPIANELPQTVFEEIEPQAGRVYDLQRLQEVLRDDEDLQFA
REILSSVEPATVKHPEYWAWKQRQMVLQSRSSEVDNEEEAMGLLSEHLECASGSFKSQGF
RKIADADKIEYLPHRRKIHKPLETVQHDSKETNSANGVGSAGGNSLQSSRVNRANNRRFA
ADISAQKQILSTESDILNLNALTKRKKPVSYARSAIHNWGLYALEPIAAKEMIIEYVGES
IRQQVAEHREKSYLRTGIGSSYLFRIDENTVIDATKKGGIARFINHCCNPSCTAKIIKVD
GKKRIVIYALRDIEANEELTYDYKFERETNDAERIRCLCGAPGCKGYLN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatacctattcatttttgaatgggaagagcaagttacaagatacacaaaatcat
gtattgcatcttcctagtttcacaaagaaacatggttccgacacaagtgataggaagcgg
aagcggaatctttttccgatgcagcatgcgcttaattatgatgaccgtgaatctgatgat
tcagacgaggaagactcaagtagatctgctactcctgttccagcaacaaagagggaagcc
gataggtttaatgatgaagaaaatgtgagttacaagcgttcaaagcttagagaaagcttt
ttgtacaatgaatattccgatgaagaaatgctggaggacggacaagaagaaccagaggag
ggcaaggtggctgaagataatgttgctgagcccaagagcgagcttgacatgatgtacgaa
cctattgcaaacgagcttccgcaaactgtgttcgaagaaattgagcctcaggctggccgt
gtctatgacttacagagattgcaggaagttctcagggacgatgaggacctccagtttgct
cgcgagatcttgtcctcagtggaacctgcaactgttaaacatcctgaatattgggcctgg
aagcaaaggcaaatggttttacaatctcgctcatccgaggtggataatgaagaagaagcc
atgggtttgttgagtgaacacttggaatgtgctagcggatcctttaagagtcagggcttc
aggaaaatcgctgatgctgacaagattgaatacttacctcaccgacgcaagattcacaaa
ccactagaaaccgtccaacatgattccaaggaaaccaatagcgctaatggagtcggatcc
gcgggcggtaatagcttgcaaagttctcgtgtcaacagagctaataatagacggtttgcc
gcagatatcagtgcccaaaagcaaattttgagtacggaatctgatattttgaatctcaat
gctttaacaaaacgaaagaagccagtttcatacgcgcgttctgctattcataactgggga
ctttatgcattggaaccaattgcggcaaaggaaatgattatcgagtatgtgggagaaagc
atccgtcagcaagtggctgagcacagagaaaagagttatttgcgcacgggcattgggtcg
tcgtatctcttccgtattgatgaaaatacagtgattgatgctacaaagaagggagggatt
gctagatttattaaccattgttgcaatccaagttgtacagctaaaatcatcaaggtggat
ggtaagaagagaatcgtcatatatgcattgcgtgacattgaagcgaatgaagaacttact
tacgattataagtttgaaagagaaacgaacgatgctgagagaattcgctgtctctgtgga
gcaccgggatgtaaaggctatttgaattag

DBGET integrated database retrieval system